Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5081
Gene name Gene Name - the full gene name approved by the HGNC.
Paired box 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAX7
Synonyms (NCBI Gene) Gene synonyms aliases
CMYO19, CMYP19, HUP1, MYOSCO, PAX7B, RMS2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and c
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs752326328 C>A,T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs1176071790 C>T Likely-pathogenic, pathogenic Stop gained, coding sequence variant
rs1392068839 C>T Pathogenic Coding sequence variant, missense variant
rs1570098248 G>A Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023463 hsa-miR-27b-3p Western blot;Other 19666532
MIRT526977 hsa-miR-4475 PAR-CLIP 22012620
MIRT526976 hsa-miR-4797-5p PAR-CLIP 22012620
MIRT526975 hsa-miR-5007-5p PAR-CLIP 22012620
MIRT526974 hsa-miR-7845-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
167410 8621 ENSG00000009709
Protein
UniProt ID P23759
Protein name Paired box protein Pax-7 (HuP1)
Protein function Transcription factor that is involved in the regulation of muscle stem cells proliferation, playing a role in myogenesis and muscle regeneration.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00292 PAX 34 161 Domain
PF00046 Homeodomain 218 274 Homeodomain Domain
PF12360 Pax7 345 385 Paired box protein 7 Family
Sequence
MAALPGTVPRMMRPAPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRQVATPDVEKKIEE
YKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLVSSISRVLR
IKFGKKEEEDEADKKEDDG
EKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTH
YPDIYTREELAQRTKLTEARVQVWFSNRRARWRK
QAGANQLAAFNHLLPGGFPPTGMPTL
PPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAADTSSAYGARHSFSS
YSDSFMNPAAPSNHMNPVSNGLSPQ
VMSILGNPSAVPPQPQADFSISPLHGGLDSATSIS
ASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQTAVDYLAKNVSLS
TQRRMKLGEHSAVLGLLPVETGQAY
Sequence length 505
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Transcriptional misregulation in cancer  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Congenital myopathy Myopathy, congenital, progressive, with scoliosis rs752326328, rs1570098248, rs1176071790, rs1392068839 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cleft Lip With Or Without Cleft Palate Cleft lip with or without cleft palate N/A N/A GWAS
Congenital Myopathy With Myasthenic-Like Onset congenital myopathy with myasthenic-like onset N/A N/A GenCC
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 27195289
Arm Injuries Associate 34389744
Breast Neoplasms Associate 33492284
Calcinosis Cutis Associate 22089931
Cleft Lip Associate 23463464, 28662356, 34684112
Cleft Palate Associate 19142206, 23463464, 23512105, 24738728, 27369588, 31122291, 31262291, 34242216, 35191549
Desmoplastic Small Round Cell Tumor Associate 24517889
Esotropia Associate 34044792
Fibrosarcoma Associate 24517889
Fibrosis Associate 23553538