Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5080
Gene name Gene Name - the full gene name approved by the HGNC.
Paired box 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAX6
Synonyms (NCBI Gene) Gene synonyms aliases
AN, AN1, AN2, ASGD5, D11S812E, FVH1, MGDA, WAGR
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes paired box protein Pax-6, one of many human homologs of the Drosophila melanogaster gene prd. In addition to a conserved paired box domain, a hallmark feature of this gene family, the encoded protein also contains a homeobox domain. Both
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121907912 G>A Pathogenic Upstream transcript variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, stop gained, non coding transcript variant
rs121907913 G>A,C Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic Coding sequence variant, genic upstream transcript variant, intron variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs121907914 G>A Pathogenic Upstream transcript variant, coding sequence variant, genic upstream transcript variant, intron variant, 5 prime UTR variant, stop gained, non coding transcript variant
rs121907915 G>C Pathogenic Genic downstream transcript variant, coding sequence variant, intron variant, stop gained, non coding transcript variant
rs121907916 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006925 hsa-miR-10b-5p Luciferase reporter assay 23034333
MIRT053153 hsa-miR-365a-3p GFP reporter assay, Western blot 23660406
MIRT438685 hsa-miR-223-3p Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 23970099
MIRT438195 hsa-miR-7-5p Luciferase reporter assay, Western blot, 25089088
MIRT438364 hsa-miR-140-5p Luciferase reporter assay, Western blot 24530397
Transcription factors
Transcription factor Regulation Reference
CTCF Activation 16723452
CTCF Repression 16723452
CTCF Unknown 15096508;17122106
FOXA2 Repression 22911885
OTX2 Activation 22085933
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000132 Process Establishment of mitotic spindle orientation IEA
GO:0000785 Component Chromatin IDA 20592023
GO:0000785 Component Chromatin IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607108 8620 ENSG00000007372
Protein
UniProt ID P26367
Protein name Paired box protein Pax-6 (Aniridia type II protein) (Oculorhombin)
Protein function Transcription factor with important functions in the development of the eye, nose, central nervous system and pancreas. Required for the differentiation of pancreatic islet alpha cells (By similarity). Competes with PAX4 in binding to a common e
PDB 2CUE , 6PAX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00292 PAX 4 128 Domain
PF00046 Homeodomain 211 267 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: Expressed in lymphoblasts. {ECO:0000269|PubMed:7958875}.; TISSUE SPECIFICITY: [Isoform 5a]: Weakly expressed in lymphoblasts. {ECO:0000269|PubMed:7958875}.
Sequence
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRY
YETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSV
SSINRVLR
NLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQ
EGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR
ERLAAKIDLPEARIQVWFSNRRAKWRR
EEKLRNQRRQASNTPSHIPISSSFSTSVYQPIP
QPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPT
SPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYWPR
LQ
Sequence length 422
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Signaling pathways regulating pluripotency of stem cells
Maturity onset diabetes of the young
  Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Aniridia Aniridia 1, Congenital aniridia rs121907918, rs1592415563, rs1131692282, rs1592435653, rs1131692313, rs1592545392, rs1592563240, rs121907928, rs1592435423, rs1554985028, rs1592654547, rs1592367623, rs1131692291, rs1131692285, rs886041222
View all (157 more)
N/A
Anterior segment dysgenesis Irido-corneo-trabecular dysgenesis rs121907913, rs587778874, rs121907917, rs1131692284 N/A
Coloboma Coloboma, ocular, autosomal dominant, Coloboma of optic nerve rs121907913, rs397514640, rs121907923, rs121907925 N/A
Foveal hypoplasia foveal hypoplasia 1 rs121907918, rs397514640, rs121907922, rs587776572, rs759557055 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Aniridia, Cerebellar Ataxia, And Mental Retardation aniridia-cerebellar ataxia-intellectual disability syndrome N/A N/A GenCC
Anophthalmia Anophthalmia N/A N/A ClinVar
Anophthalmia/Microphthalmia-Esophageal Atresia Syndrome Anophthalmia-microphthalmia syndrome N/A N/A ClinVar
Foveal Hypoplasia-Presenile Cataract Syndrome foveal hypoplasia-presenile cataract syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28533502
Adenomatous Polyposis Coli Associate 17873900
Agenesis of Corpus Callosum Associate 19862335
Al Awadi syndrome Associate 23734086
Albinism Ocular Associate 28667292
Alcohol Related Disorders Associate 39212610
Aniridia Associate 10441571, 11826019, 12386836, 12782766, 12789139, 1334370, 15086958, 15307048, 15889018, 15918896, 16617299, 16785853, 16803629, 17417613, 17630404
View all (93 more)
Aniridia cerebellar ataxia mental deficiency Associate 27124303
Anisometropia Associate 37266952
Anophthalmia with pulmonary hypoplasia Associate 31700164