Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5076
Gene name Gene Name - the full gene name approved by the HGNC.
Paired box 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAX2
Synonyms (NCBI Gene) Gene synonyms aliases
FSGS7, PAPRS, PAX-2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcrip
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41291450 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, genic downstream transcript variant, synonymous variant
rs75399846 C>T Pathogenic, not-provided Stop gained, genic downstream transcript variant, coding sequence variant
rs75462234 G>-,GG,GGG Pathogenic Frameshift variant, genic downstream transcript variant, coding sequence variant
rs76675173 TGGCCCACCAGGGTGTGCGGCC>- Pathogenic Frameshift variant, genic downstream transcript variant, coding sequence variant
rs77777862 C>- Pathogenic Frameshift variant, genic downstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT038163 hsa-miR-423-5p CLASH 23622248
MIRT488364 hsa-miR-1321 PAR-CLIP 23592263
MIRT488363 hsa-miR-4739 PAR-CLIP 23592263
MIRT488362 hsa-miR-4756-5p PAR-CLIP 23592263
MIRT488361 hsa-miR-4688 PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
WT1 Repression 9738017;9916932
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 9178767, 16368682, 16735463, 19048125
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
167409 8616 ENSG00000075891
Protein
UniProt ID Q02962
Protein name Paired box protein Pax-2
Protein function Transcription factor that may have a role in kidney cell differentiation (PubMed:24676634). Has a critical role in the development of the urogenital tract, the eyes, and the CNS.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00292 PAX 16 140 Domain
PF12403 Pax2_C 304 416 Paired-box protein 2 C terminal Family
Tissue specificity TISSUE SPECIFICITY: Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system.
Sequence
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIR
TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDS
QSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAG
MVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDR
H
Sequence length 417
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Focal segmental glomerulosclerosis focal segmental glomerulosclerosis 7 rs76492282, rs75462234, rs79555199, rs759356936, rs1131692055 N/A
Renal Coloboma Syndrome renal coloboma syndrome, Papillorenal syndrome with macular abnormalities rs76492282, rs75399846, rs77777862, rs76675173, rs79555199, rs387906530, rs1589813539, rs75462234, rs78122364, rs104894170, rs759356936 N/A
Congenital anomalies of kidney and urinary tract Congenital anomaly of kidney and urinary tract rs75462234 N/A
renal cyst Renal cyst rs1057518761 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Severe insulin-resistant type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Nephrotic Syndrome familial idiopathic steroid-resistant nephrotic syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 12200552, 16400326
Adenoma Oxyphilic Associate 15502805, 24771139
Adenoma Pleomorphic Associate 24771139
Alcohol Related Disorders Associate 31060108, 34696790, 36835576, 40282888
Breast Neoplasms Associate 19005469, 22168360, 24203627, 28412963, 32843722
Cakut Associate 23539225, 24429398, 24676634, 26489027, 27657687, 32203225, 34696790, 36835576
Carcinogenesis Associate 14627715, 20562848, 20597068, 20631067, 23890189, 27764784, 29270778
Carcinoma Acinar Cell Associate 24771139
Carcinoma Hepatocellular Associate 35028121
Carcinoma in Situ Associate 20562848