Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5074
Gene name Gene Name - the full gene name approved by the HGNC.
Pro-apoptotic WT1 regulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAWR
Synonyms (NCBI Gene) Gene synonyms aliases
PAR4, Par-4
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-medi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024766 hsa-miR-215-5p Microarray 19074876
MIRT026315 hsa-miR-192-5p Microarray 19074876
MIRT513790 hsa-miR-107 PAR-CLIP 20371350
MIRT513789 hsa-miR-103a-3p PAR-CLIP 20371350
MIRT513788 hsa-miR-92b-3p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IEA
GO:0003714 Function Transcription corepressor activity TAS 8943350
GO:0003779 Function Actin binding ISS
GO:0005515 Function Protein binding IPI 11755531, 16369487, 18660514, 19632185, 20561531, 25218743
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601936 8614 ENSG00000177425
Protein
UniProt ID Q96IZ0
Protein name PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4)
Protein function Pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the
PDB 2JK9
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers. {ECO:0000269|PubMed:89433
Sequence
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT
PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA
PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD
EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR
YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
Sequence length 340
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 15877079
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 15877079
Endometrial carcinoma Endometrial Carcinoma rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077
View all (247 more)
15877079
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 15877079
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 20735158, 18085546 ClinVar
Coronary artery disease Coronary artery disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 11278808
Alzheimer Disease Stimulate 30518159
Breast Neoplasms Associate 23760770, 26126114, 29330285, 31217499
Cap Myopathy Associate 25803782
Carcinoma Renal Cell Associate 37024613
Colorectal Neoplasms Inhibit 20433755
Colorectal Neoplasms Associate 27938501
Glioma Associate 24523904, 32135176
Hypopharyngeal Neoplasms Associate 24418097
Hypoxia Associate 35251305