Gene Gene information from NCBI Gene database.
Entrez ID 5074
Gene name Pro-apoptotic WT1 regulator
Gene symbol PAWR
Synonyms (NCBI Gene)
PAR4Par-4
Chromosome 12
Chromosome location 12q21.2
Summary This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-medi
miRNA miRNA information provided by mirtarbase database.
311
miRTarBase ID miRNA Experiments Reference
MIRT024766 hsa-miR-215-5p Microarray 19074876
MIRT026315 hsa-miR-192-5p Microarray 19074876
MIRT513790 hsa-miR-107 PAR-CLIP 20371350
MIRT513789 hsa-miR-103a-3p PAR-CLIP 20371350
MIRT513788 hsa-miR-92b-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 8943350
GO:0000785 Component Chromatin IEA
GO:0003714 Function Transcription corepressor activity TAS 8943350
GO:0003779 Function Actin binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601936 8614 ENSG00000177425
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96IZ0
Protein name PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4)
Protein function Pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the
PDB 2JK9
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers. {ECO:0000269|PubMed:89433
Sequence
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT
PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA
PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD
EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR
YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI
GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
Sequence length 340
Interactions View interactions