SLC45A1 (solute carrier family 45 member 1)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
50651
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 45 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC45A1
Synonyms (NCBI Gene) Gene synonyms aliases
DNB5, IDDNPF, PAST-A
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IDDNPF
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was isolated initially from a region on chromosome 1p that is frequently deleted in human neuroblastoma, although no causal relationship has since been demonstrated. The encoded protein belongs to the glycoside-pentoside-hexuronide cation sympor
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs150539474 C>T Pathogenic Missense variant, coding sequence variant
rs781036625 C>T Pathogenic Missense variant, coding sequence variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT017767 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0008506 Function Sucrose:proton symporter activity IBA 21873635
GO:0015770 Process Sucrose transport IEA
GO:0016020 Component Membrane IBA 21873635
GO:0016021 Component Integral component of membrane IEA
GO:1904659 Process Glucose transmembrane transport IMP 28434495
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605763 17939 ENSG00000162426
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9Y2W3
Protein name Proton-associated sugar transporter A (PAST-A) (Deleted in neuroblastoma 5 protein) (DNb-5) (Solute carrier family 45 member 1)
Protein function Proton-associated glucose transporter in the brain.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07690 MFS_1 105 → 403 Major Facilitator Superfamily Family
Tissue specificity TISSUE SPECIFICITY: Expressed in adult heart, brain, muscle and kidney, with very strong expression in brain. Also expressed in fetal brain, kidney and lung. {ECO:0000269|PubMed:10729226}.
Sequence 
MLQQPGPRPGRQQPSGDRDACRLHPQGRPPALPTMIPAASSTPPGDALFPSVAPQDFWRS
QVTGYSGSVTRHLSHRANNFKRHPKRRKCIRPSPPPPPNTPCPLELVDFGDLHPQRSFRE
LLFNGCILFGIEFSYAMETAYVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDR
CTSRFGRRRPFILVLAIGALLGLSLLLNGRDIGIALADVTGNHKWGLLLTVCGVVLMDFS
ADSADNPSHAYMMDVCSPADQDRGLNIHALLAGLGGGFGYVVGGIHWDKTGFGRALGGQL
RVIYLFTAVTLSVTTVLTLVSIPERPLRPPSEKRAAMKSPSLPLPPSPPVLPEEGPGDSL
PSHTATNFSSPISPPSPLTPKYGSFISRDSSLTGISEFASSFGTANIDSVLIDCFTGGHD
SYLAIPGSVPRPPISVSFPRAPDGFYRQDRGLLEGREGALTSGCDGDILRVGSLDTSKPR
SSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNGVKYESELTGSSERAEQP
LSVGRLCSTICNMPKALRTLCVNHFLGWLSFEGMLLFYTDFMGEVVFQGDPKAPHTSEAY
QKYNSGVTMGCWGMCIYAFSAAFYSAILEKLEEFLSVRTLYFIAYLAFGLGTGLATLSRN
LYVVLSLCITYGILFSTLCTLPYSLLCDYYQSKKFAGSSADGTRRGMGVDISLLSCQYFL
AQILVSLVLGPLTSAVGSANGVMYFSSLVSFLGCLYSSLFVIYEIPPSDAADEEHRPLLL
NV
Sequence length 782
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (9)
Causal
Disease term Disease name dbSNP ID References
Autism Autistic behavior rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Intellectual developmental disorder with neuropsychiatric features INTELLECTUAL DEVELOPMENTAL DISORDER WITH NEUROPSYCHIATRIC FEATURES rs150539474 27431290, 28434495
Mental retardation Severe intellectual disability, Mild Mental Retardation, Moderate intellectual disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Intellectual Developmental Disorder With Neuropsychiatric Features intellectual developmental disorder with neuropsychiatric features GenCC
Non-Syndromic Intellectual Disability autosomal recessive non-syndromic intellectual disability GenCC
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Melanoma Associate 34334114