Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5058
Gene name Gene Name - the full gene name approved by the HGNC.	P21 (RAC1) activated kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PAK1
Synonyms (NCBI Gene) Gene synonyms aliases	IDDMSSD, PAKalpha, alpha-PAK, p65-PAK
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IDDMSSD
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.5-q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small G

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565583382	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs1565638316	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, missense variant
rs1591695781	A>G	Likely-pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant

Show/Hide all(139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000991	hsa-miR-377-3p	Luciferase reporter assay, Western blot	18716028
MIRT000668	hsa-miR-7-5p	Review	19935707
MIRT000668	hsa-miR-7-5p	Luciferase reporter assay, Western blot	18922890
MIRT005336	mmu-miR-465a-5p	Luciferase reporter assay, Western blot	18922890
MIRT023312	hsa-miR-122-5p	Microarray	17612493
MIRT000668	hsa-miR-7-5p	Microarray	19073608
MIRT029738	hsa-miR-26b-5p	Microarray	19088304
MIRT051883	hsa-let-7b-5p	CLASH	23622248
MIRT044750	hsa-miR-320a	CLASH	23622248
MIRT038058	hsa-miR-423-5p	CLASH	23622248
MIRT053026	hsa-let-7a-5p	Immunofluorescence, qRT-PCR, Western blot, Luciferase reporter assay	23339187
MIRT054901	hsa-miR-221-3p	Luciferase reporter assay	23333386
MIRT054901	hsa-miR-221-3p	Luciferase reporter assay	23333386
MIRT531438	hsa-miR-3133	PAR-CLIP	22012620
MIRT531437	hsa-miR-216a-5p	PAR-CLIP	22012620
MIRT531436	hsa-miR-4744	PAR-CLIP	22012620
MIRT531435	hsa-miR-520d-5p	PAR-CLIP	22012620
MIRT531434	hsa-miR-524-5p	PAR-CLIP	22012620
MIRT531433	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT000668	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27430434
MIRT531438	hsa-miR-3133	PAR-CLIP	22012620
MIRT531437	hsa-miR-216a-5p	PAR-CLIP	22012620
MIRT531436	hsa-miR-4744	PAR-CLIP	22012620
MIRT531435	hsa-miR-520d-5p	PAR-CLIP	22012620
MIRT531434	hsa-miR-524-5p	PAR-CLIP	22012620
MIRT531433	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT755545	hsa-miR-497-3p	Luciferase reporter assay, Western blotting, Flow cytometry	35066776
MIRT756365	hsa-miR-6788-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	36636079
MIRT1211184	hsa-miR-1200	CLIP-seq
MIRT1211185	hsa-miR-1207-3p	CLIP-seq
MIRT1211186	hsa-miR-1224-5p	CLIP-seq
MIRT1211187	hsa-miR-1264	CLIP-seq
MIRT1211188	hsa-miR-1271	CLIP-seq
MIRT1211189	hsa-miR-186	CLIP-seq
MIRT1211190	hsa-miR-216a	CLIP-seq
MIRT1211191	hsa-miR-2467-5p	CLIP-seq
MIRT1211192	hsa-miR-3140-5p	CLIP-seq
MIRT1211193	hsa-miR-3150b-3p	CLIP-seq
MIRT1211194	hsa-miR-3188	CLIP-seq
MIRT1211195	hsa-miR-342-3p	CLIP-seq
MIRT1211196	hsa-miR-377	CLIP-seq
MIRT1211197	hsa-miR-3915	CLIP-seq
MIRT1211198	hsa-miR-3973	CLIP-seq
MIRT1211199	hsa-miR-3975	CLIP-seq
MIRT1211200	hsa-miR-4292	CLIP-seq
MIRT1211201	hsa-miR-4308	CLIP-seq
MIRT1211202	hsa-miR-4663	CLIP-seq
MIRT1211203	hsa-miR-4689	CLIP-seq
MIRT1211204	hsa-miR-4731-3p	CLIP-seq
MIRT1211205	hsa-miR-4784	CLIP-seq
MIRT1211206	hsa-miR-4801	CLIP-seq
MIRT1211207	hsa-miR-485-5p	CLIP-seq
MIRT1211208	hsa-miR-494	CLIP-seq
MIRT1211209	hsa-miR-499-3p	CLIP-seq
MIRT1211210	hsa-miR-499a-3p	CLIP-seq
MIRT1211211	hsa-miR-520g	CLIP-seq
MIRT1211212	hsa-miR-520h	CLIP-seq
MIRT1211213	hsa-miR-526b	CLIP-seq
MIRT1211214	hsa-miR-96	CLIP-seq
MIRT2060618	hsa-miR-141	CLIP-seq
MIRT2060619	hsa-miR-200a	CLIP-seq
MIRT1211191	hsa-miR-2467-5p	CLIP-seq
MIRT1211194	hsa-miR-3188	CLIP-seq
MIRT1211199	hsa-miR-3975	CLIP-seq
MIRT1211207	hsa-miR-485-5p	CLIP-seq
MIRT1211208	hsa-miR-494	CLIP-seq
MIRT2060620	hsa-miR-513c	CLIP-seq
MIRT2060621	hsa-miR-514b-5p	CLIP-seq
MIRT2289292	hsa-miR-1287	CLIP-seq
MIRT2289293	hsa-miR-2117	CLIP-seq
MIRT2289294	hsa-miR-2467-3p	CLIP-seq
MIRT2289295	hsa-miR-3135b	CLIP-seq
MIRT2289296	hsa-miR-3187-3p	CLIP-seq
MIRT2289297	hsa-miR-3691-3p	CLIP-seq
MIRT2289298	hsa-miR-4435	CLIP-seq
MIRT2289299	hsa-miR-455-5p	CLIP-seq
MIRT2289300	hsa-miR-4638-3p	CLIP-seq
MIRT2289301	hsa-miR-4727-3p	CLIP-seq
MIRT2289302	hsa-miR-4729	CLIP-seq
MIRT2289303	hsa-miR-615-5p	CLIP-seq
MIRT2586997	hsa-let-7a	CLIP-seq
MIRT2586998	hsa-let-7b	CLIP-seq
MIRT2586999	hsa-let-7c	CLIP-seq
MIRT2587000	hsa-let-7d	CLIP-seq
MIRT2587001	hsa-let-7e	CLIP-seq
MIRT2587002	hsa-let-7f	CLIP-seq
MIRT2587003	hsa-let-7g	CLIP-seq
MIRT2587004	hsa-let-7i	CLIP-seq
MIRT2060618	hsa-miR-141	CLIP-seq
MIRT2060619	hsa-miR-200a	CLIP-seq
MIRT2587005	hsa-miR-3157-3p	CLIP-seq
MIRT2587006	hsa-miR-3679-3p	CLIP-seq
MIRT1211196	hsa-miR-377	CLIP-seq
MIRT2587007	hsa-miR-410	CLIP-seq
MIRT2289298	hsa-miR-4435	CLIP-seq
MIRT2587008	hsa-miR-4446-5p	CLIP-seq
MIRT2587009	hsa-miR-4458	CLIP-seq
MIRT2587010	hsa-miR-4459	CLIP-seq
MIRT2587011	hsa-miR-4487	CLIP-seq
MIRT2587012	hsa-miR-4500	CLIP-seq
MIRT2587013	hsa-miR-4520a-3p	CLIP-seq
MIRT2289299	hsa-miR-455-5p	CLIP-seq
MIRT2289300	hsa-miR-4638-3p	CLIP-seq
MIRT2587014	hsa-miR-4690-5p	CLIP-seq
MIRT2587015	hsa-miR-4722-5p	CLIP-seq
MIRT2289301	hsa-miR-4727-3p	CLIP-seq
MIRT2289302	hsa-miR-4729	CLIP-seq
MIRT1211204	hsa-miR-4731-3p	CLIP-seq
MIRT2587016	hsa-miR-4732-5p	CLIP-seq
MIRT2587017	hsa-miR-4797-3p	CLIP-seq
MIRT1211206	hsa-miR-4801	CLIP-seq
MIRT1211208	hsa-miR-494	CLIP-seq
MIRT1211209	hsa-miR-499-3p	CLIP-seq
MIRT1211210	hsa-miR-499a-3p	CLIP-seq
MIRT2060620	hsa-miR-513c	CLIP-seq
MIRT2060621	hsa-miR-514b-5p	CLIP-seq
MIRT2587018	hsa-miR-548aa	CLIP-seq
MIRT2587019	hsa-miR-548n	CLIP-seq
MIRT2587020	hsa-miR-548p	CLIP-seq
MIRT2587021	hsa-miR-548t	CLIP-seq
MIRT2587022	hsa-miR-552	CLIP-seq
MIRT2587023	hsa-miR-589	CLIP-seq
MIRT2289303	hsa-miR-615-5p	CLIP-seq
MIRT2587024	hsa-miR-642b	CLIP-seq
MIRT2587025	hsa-miR-7	CLIP-seq
MIRT2587026	hsa-miR-764	CLIP-seq
MIRT2587027	hsa-miR-98	CLIP-seq
MIRT1211196	hsa-miR-377	CLIP-seq
MIRT2587011	hsa-miR-4487	CLIP-seq
MIRT2587013	hsa-miR-4520a-3p	CLIP-seq
MIRT2289300	hsa-miR-4638-3p	CLIP-seq
MIRT1211204	hsa-miR-4731-3p	CLIP-seq
MIRT2587016	hsa-miR-4732-5p	CLIP-seq
MIRT1211206	hsa-miR-4801	CLIP-seq
MIRT1211208	hsa-miR-494	CLIP-seq
MIRT1211209	hsa-miR-499-3p	CLIP-seq
MIRT1211210	hsa-miR-499a-3p	CLIP-seq
MIRT2587022	hsa-miR-552	CLIP-seq
MIRT2587026	hsa-miR-764	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
HLX	Unknown	22897850

Show/Hide all(75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	8805275
GO:0001666	Process	Response to hypoxia	IEA
GO:0001726	Component	Ruffle	IDA	12912914
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	23633677
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IDA	8805275, 9852149
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	10559936, 11278486
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16278681, 19667065, 23260667
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10026169, 10559936, 11030651, 11864573, 12606577, 12624090, 12879077, 16101281, 16278681, 16407834, 16413544, 16492808, 16628223, 17245428, 17389360, 18325335, 18716323, 18854161, 19270716, 19435845, 19596003, 19693014, 19732720, 19893577, 20810653, 20936779, 21029865, 21167153, 214
GO:0005518	Function	Collagen binding	IPI	12189148
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA	23260667
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	16278681, 23260667, 25766321
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IDA	9395435
GO:0005886	Component	Plasma membrane	IDA	16278681
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	12912914
GO:0005925	Component	Focal adhesion	IEA
GO:0006338	Process	Chromatin remodeling	IDA	23260667
GO:0006468	Process	Protein phosphorylation	IDA	9852149, 23260667
GO:0006887	Process	Exocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	23260667
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	23333386
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0014704	Component	Intercalated disc	ISS
GO:0016477	Process	Cell migration	IMP	27917469
GO:0019901	Function	Protein kinase binding	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030018	Component	Z disc	ISS
GO:0030027	Component	Lamellipodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	25766321
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IBA	21873635
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	25198505
GO:0031267	Function	Small GTPase binding	IPI	11950598
GO:0031295	Process	T cell costimulation	TAS
GO:0031532	Process	Actin cytoskeleton reorganization	IDA	9395435
GO:0031532	Process	Actin cytoskeleton reorganization	IMP	16278681, 27917469
GO:0031965	Component	Nuclear membrane	ISS
GO:0032147	Process	Activation of protein kinase activity	IBA	21873635
GO:0032587	Component	Ruffle membrane	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032991	Component	Protein-containing complex	IDA	11864573, 11950598
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	19667065
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IDA	16278681
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042060	Process	Wound healing	IMP	12912914
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	8805275
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	8805275
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IMP	25198505
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IMP	20457839
GO:0048812	Process	Neuron projection morphogenesis	ISS
GO:0050770	Process	Regulation of axonogenesis	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	11864573
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	IMP	12912914
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IEA

MIM	HGNC	e!Ensembl
602590	8590	ENSG00000149269

Protein

UniProt ID

Q13153

Protein name

Serine/threonine-protein kinase PAK 1 (EC 2.7.11.1) (Alpha-PAK) (p21-activated kinase 1) (PAK-1) (p65-PAK)

Protein function

Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-m

PDB

1F3M , 1YHV , 1YHW , 1ZSG , 2HY8 , 2QME , 3DVP , 3FXZ , 3FY0 , 3Q4Z , 3Q52 , 3Q53 , 4DAW , 4EQC , 4O0R , 4O0T , 4P90 , 4ZJI , 4ZJJ , 4ZLO , 4ZY4 , 4ZY5 , 4ZY6 , 5DEW , 5DEY , 5DFP , 5IME , 5KBQ , 5KBR , 6B16 , 7VTO , 8X5Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00786	PBD	74 → 132	P21-Rho-binding domain	Domain
PF00069	Pkinase	270 → 521	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in gastric cancer cells and tissues (at protein level) (PubMed:25766321). {ECO:0000269|PubMed:25766321}.

Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH

Sequence length

545

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway ErbB signaling pathway Ras signaling pathway cAMP signaling pathway Chemokine signaling pathway Axon guidance Hippo signaling pathway - multiple species Focal adhesion C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity T cell receptor signaling pathway Fc gamma R-mediated phagocytosis Regulation of actin cytoskeleton Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Salmonella infection Human immunodeficiency virus 1 infection Proteoglycans in cancer Renal cell carcinoma		Generation of second messenger molecules Regulation of actin dynamics for phagocytic cup formation FCERI mediated MAPK activation DSCAM interactions CD28 dependent Vav1 pathway EPHB-mediated forward signaling Ephrin signaling Sema3A PAK dependent Axon repulsion Signal transduction by L1 Smooth Muscle Contraction VEGFR2 mediated vascular permeability CD209 (DC-SIGN) signaling RHO GTPases activate PAKs MAPK6/MAPK4 signaling G beta:gamma signalling through CDC42

Show/Hide Causal Diseases (10)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	20179234
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	20179234
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Intellectual developmental disorder with macrocephaly, seizures, and speech delay	INTELLECTUAL DEVELOPMENTAL DISORDER WITH MACROCEPHALY, SEIZURES, AND SPEECH DELAY	rs1565638316, rs1565583382, rs1591695781	30290153, 31504246
Mental retardation	Severe intellectual disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	20179234
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)
Neurodevelopmental disorders	Neurodevelopmental Disorders	rs869312846, rs869312840, rs869312848, rs869312849, rs869312845, rs886041956, rs1064795110, rs1555762734, rs1555764992, rs1568512728, rs1568532361, rs1595472741, rs1595472764, rs1595476797, rs1016320330, rs1595127294, rs1600392059 View all (2 more)	30290153
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	17621631
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	17621631

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma		17621631	ClinVar

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	24236193
Adenomatous Polyps	Stimulate	26423403
Adenomyosis	Stimulate	20079895
Alopecia	Associate	28098826
Anemia Hemolytic	Associate	26466379
Asthma	Associate	35606385
Autistic Disorder	Associate	31504246
Brain Diseases	Associate	33945512
Breast Neoplasms	Associate	10766836, 10945974, 12151336, 15178330, 16026643, 18283314, 18392133, 18411304, 18922890, 19317917, 21209852, 22105362, 23289893, 23339187, 23361053 View all (9 more)
Carcinogenesis	Associate	25569743, 25902869, 26377044, 26884861, 27229476, 28186966, 32186433, 36443711
Carcinoma Endometrioid	Stimulate	26218748
Carcinoma Hepatocellular	Associate	23516476, 24347489, 30543848, 36675278, 37537668
Carcinoma Non Small Cell Lung	Associate	22848689, 25956913, 27713506, 30955235, 33261184
Carcinoma Non Small Cell Lung	Stimulate	35500159
Carcinoma Pancreatic Ductal	Associate	27321183
Carcinoma Small Cell	Associate	26023713
Cholangiocarcinoma	Associate	34799729
Ciliary Dyskinesia With Transposition Of Ciliary Microtubules	Associate	25902869
Colitis Associated Neoplasms	Associate	25569743
Colonic Neoplasms	Associate	26423403
Colorectal Neoplasms	Associate	20595063, 23233484, 25174975, 25182632, 25409929, 26884861
Colorectal Neoplasms	Stimulate	26423403
COVID 19	Stimulate	33950285
Cysts	Associate	21722895
Developmental Disabilities	Associate	30290153, 36624491
Diabetes Gestational	Associate	33890634
DNA Virus Infections	Associate	22971344
Down Syndrome	Associate	33945512, 35301086
Drug Related Side Effects and Adverse Reactions	Associate	31516713
Endometrial Neoplasms	Stimulate	26218748
Endometriosis	Associate	20079895
Fibrosis	Associate	37967011
Gait Ataxia	Associate	30290153
Glioblastoma	Associate	30705404
Glioblastoma	Stimulate	32186433
Glioma	Associate	40715243
Hepatitis Autoimmune	Stimulate	26986756
Hereditary Breast and Ovarian Cancer Syndrome	Associate	27427770
HIV Infections	Inhibit	15574879
HIV Infections	Associate	16352537
Hydrocephalus	Associate	31504246
Hypoxia	Associate	32186433
Infections	Stimulate	21881052
Inflammatory Bowel Diseases	Associate	25569743
Inflammatory Breast Neoplasms	Associate	23280128
Intellectual Disability	Associate	31504246, 36624491
Language Development Disorders	Associate	36624491
Leukemia Lymphocytic Chronic B Cell	Associate	36478132
Leukemia Myeloid Acute	Associate	34536536
Leukemia Prolymphocytic T Cell	Associate	35811334
Liver Cirrhosis	Associate	37967011
Lung Neoplasms	Associate	26377044, 33261184
Lymphatic Metastasis	Associate	20426825, 20591216
Lymphatic Metastasis	Stimulate	23298303, 24236193, 25412958, 26023713
Lymphoma	Associate	23300274
Lymphoma T Cell Cutaneous	Associate	31304555
Megalencephaly	Associate	30290153, 31504246, 36624491
Melanoma	Associate	15066181, 22971344, 28373299, 30657954, 31516713, 33067454
Melanoma Cutaneous Malignant	Associate	28373299
Meningioma	Associate	26219339
Mouth Neoplasms	Stimulate	27229476
Neoplasm Invasiveness	Associate	20426825
Neoplasm Metastasis	Associate	20591216, 23298303, 23516476, 24236193, 24347489, 25766321, 26023713, 28186966, 29099290, 36054930
Neoplasms	Associate	12937139, 15193260, 16026643, 18411304, 18922890, 20426825, 20591216, 22105362, 22130069, 22869096, 23516476, 24236193, 25182632, 25956913, 26023713 View all (17 more)
Neoplasms	Stimulate	25412958
Neurofibromatosis Noonan syndrome	Associate	30290153
Oncogene Addiction	Associate	29133945
Ovarian Neoplasms	Associate	12937139, 29099290
Ovarian Neoplasms	Stimulate	27427770
Pancreatic Neoplasms	Associate	25182632, 25409929
Papilloma	Associate	20131316
Parkinson Disease	Associate	35563596
Polyps	Associate	26423403
Prostatic Neoplasms	Associate	28186966, 31516713
Prostatitis	Associate	31516713
Retinal Dysplasia	Associate	23298303
Rhabdomyosarcoma	Associate	20956521
Seizures	Associate	30290153, 31504246, 36624491
Seizures Febrile	Associate	31504246
Squamous Cell Carcinoma of Head and Neck	Associate	27229476, 28535002
Stomach Diseases	Associate	30773850
Stomach Neoplasms	Associate	19448398, 20331625, 20591216, 23298303, 25182632, 25766321, 26379399, 30773850, 37225681
Thyroid Cancer Papillary	Associate	20817787
Thyroid Neoplasms	Associate	20817787, 23709653
Triple Negative Breast Neoplasms	Associate	33321758
Urinary Bladder Neoplasms	Associate	25412958
VACTERL association	Associate	37328543

PAK1 (p21 (RAC1) activated kinase 1)