Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5055
Gene name	Serpin family B member 2
Gene symbol	SERPINB2
Synonyms (NCBI Gene)	HsT1201PAIPAI-2PAI2PLANH2
Chromosome	18
Chromosome location	18q21.33-q22.1

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023021	hsa-miR-124-3p	Microarray	18668037
MIRT030054	hsa-miR-26b-5p	Microarray	19088304
MIRT1338685	hsa-miR-3132	CLIP-seq
MIRT1338686	hsa-miR-3591-5p	CLIP-seq
MIRT1338687	hsa-miR-4460	CLIP-seq
MIRT1338688	hsa-miR-4652-3p	CLIP-seq
MIRT1338689	hsa-miR-4727-3p	CLIP-seq
MIRT1338690	hsa-miR-4735-5p	CLIP-seq
MIRT1338691	hsa-miR-944	CLIP-seq
MIRT2620586	hsa-miR-296-3p	CLIP-seq
MIRT2620587	hsa-miR-298	CLIP-seq
MIRT1338685	hsa-miR-3132	CLIP-seq
MIRT2620588	hsa-miR-323b-5p	CLIP-seq
MIRT1338686	hsa-miR-3591-5p	CLIP-seq
MIRT2620589	hsa-miR-369-3p	CLIP-seq
MIRT2620590	hsa-miR-374a	CLIP-seq
MIRT2620591	hsa-miR-374b	CLIP-seq
MIRT2620592	hsa-miR-382	CLIP-seq
MIRT2620593	hsa-miR-3945	CLIP-seq
MIRT2620594	hsa-miR-4253	CLIP-seq
MIRT1338687	hsa-miR-4460	CLIP-seq
MIRT1338688	hsa-miR-4652-3p	CLIP-seq
MIRT2620595	hsa-miR-4694-3p	CLIP-seq
MIRT1338689	hsa-miR-4727-3p	CLIP-seq
MIRT1338690	hsa-miR-4735-5p	CLIP-seq
MIRT2620596	hsa-miR-4799-5p	CLIP-seq
MIRT2620597	hsa-miR-522	CLIP-seq
MIRT2620598	hsa-miR-633	CLIP-seq
MIRT1338691	hsa-miR-944	CLIP-seq
MIRT2620586	hsa-miR-296-3p	CLIP-seq
MIRT2620587	hsa-miR-298	CLIP-seq
MIRT1338685	hsa-miR-3132	CLIP-seq
MIRT2620588	hsa-miR-323b-5p	CLIP-seq
MIRT1338686	hsa-miR-3591-5p	CLIP-seq
MIRT2620589	hsa-miR-369-3p	CLIP-seq
MIRT2620590	hsa-miR-374a	CLIP-seq
MIRT2620591	hsa-miR-374b	CLIP-seq
MIRT2620592	hsa-miR-382	CLIP-seq
MIRT2620593	hsa-miR-3945	CLIP-seq
MIRT2620594	hsa-miR-4253	CLIP-seq
MIRT1338687	hsa-miR-4460	CLIP-seq
MIRT1338688	hsa-miR-4652-3p	CLIP-seq
MIRT2620595	hsa-miR-4694-3p	CLIP-seq
MIRT1338689	hsa-miR-4727-3p	CLIP-seq
MIRT1338690	hsa-miR-4735-5p	CLIP-seq
MIRT2620596	hsa-miR-4799-5p	CLIP-seq
MIRT2620597	hsa-miR-522	CLIP-seq
MIRT2620598	hsa-miR-633	CLIP-seq
MIRT1338691	hsa-miR-944	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZFP36	Unknown	12578825

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0042730	Process	Fibrinolysis	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7499264

MIM	HGNC	e!Ensembl
173390	8584	ENSG00000197632

P05120

Protein name

Plasminogen activator inhibitor 2 (PAI-2) (Monocyte Arg-serpin) (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor)

Protein function

Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

PDB

1BY7 , 1JRR , 2ARQ , 2ARR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 415	Serpin (serine protease inhibitor)	Domain

Sequence

MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQF
NEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGN
YLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGK
IPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK
LNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMV
DVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades		Dissolution of Fibrin Clot Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Uncertain significance	rs184826316	RCV005931020
Ovarian serous cystadenocarcinoma	Uncertain significance	rs184826316	RCV005931021

Show/Hide Text Mining Associations (61)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	20496126
Alphavirus Infections	Associate	9607921
Angioedema	Associate	28578223
Arthritis Rheumatoid	Associate	8646430
Asthma	Associate	17898169, 24075231, 28701525, 28933920, 31430856, 31903716, 34106513, 35550122, 37241840, 37438356
Atherosclerosis	Associate	26573152
Blister	Associate	8879451
Breast Neoplasms	Associate	17696882, 31359505, 8641985, 9303361
Calcinosis Cutis	Stimulate	34502091
Carcinoma Non Small Cell Lung	Associate	10811500, 26230665, 27558531, 32404981
Carcinoma Papillary	Associate	15208622
Cardiovascular Diseases	Associate	26573152
Cholangiocarcinoma	Associate	24935374, 29347950
Colorectal Neoplasms	Associate	16038031, 7737909
Coronary Artery Disease	Associate	14653443, 26573152
Drug Resistant Epilepsy	Associate	26573152
Esophageal Neoplasms	Associate	36497110
Esophageal Squamous Cell Carcinoma	Associate	10666386
Fatigue	Associate	37881427
Fetal Growth Retardation	Inhibit	8018914
Fibrosarcoma	Associate	10469140, 11018526
Gallbladder Neoplasms	Associate	18497548
Glioblastoma	Associate	39684695
Gliosarcoma	Associate	7485395
Hereditary Angioedema Type III	Associate	31359505
Immunoglobulin G4 Related Disease	Associate	2138329
Inflammation	Stimulate	22527886, 28578223, 36497110
Inflammation	Associate	34106513, 7499264, 8916932, 9780231
Liver Cirrhosis	Associate	34648138
Lung Neoplasms	Associate	26230665, 27558531, 9743310
Lupus Erythematosus Systemic	Associate	18818228
Lymphatic Metastasis	Associate	7737909, 8641985
Lymphatic Metastasis	Inhibit	9743310
Lymphoma Large B Cell Diffuse	Associate	3325828
Melanoma	Associate	8144583, 8291613, 8900173
Mesothelioma Malignant	Associate	7485395
Multiple Sclerosis	Associate	14653443
Myocardial Infarction	Associate	14653443
Nasopharyngeal Carcinoma	Associate	30864656
Neoplasm Metastasis	Associate	10811500, 26799588, 29432180, 8291613, 8641985, 9743310
Neoplasm Metastasis	Inhibit	7737909
Neoplasms	Associate	10666386, 10811500, 20496126, 2138329, 21606492, 24935374, 26230665, 29347950, 29432180, 30808882, 33057845, 39684695, 7737909, 8291613, 8641985, 9743310 View all (1 more)
Neoplasms	Inhibit	12944478, 16838325, 36497110
Neoplasms	Stimulate	31359505, 3325828
Neoplasms Basal Cell	Associate	30808882
Ovarian Neoplasms	Associate	15208622, 15305371
Pancreatic Neoplasms	Associate	31609478
Pemphigoid Bullous	Associate	8879451
Pre Eclampsia	Inhibit	8018914
Premature Birth	Associate	23689979
Prostatic Neoplasms	Associate	12841684
Scleroderma Systemic	Inhibit	20943061
Seminoma	Associate	20403162
Sepsis	Stimulate	32496420
Soft Tissue Injuries	Associate	21314733
Spina Bifida Occulta	Associate	8879451
Stomach Neoplasms	Associate	36241983
Stress Disorders Post Traumatic	Associate	38212778
Tertiary Lymphoid Structures	Inhibit	8641985
Thrombosis	Associate	18818228
Vascular Remodeling	Associate	27048385

SERPINB2 (serpin family B member 2)