Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5052
Gene name Gene Name - the full gene name approved by the HGNC.	Peroxiredoxin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRDX1
Synonyms (NCBI Gene) Gene synonyms aliases	MSP23, NKEF-A, NKEFA, PAG, PAGA, PAGB, PRX1, PRXI, TDPX2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of C

Show/Hide all(82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019836	hsa-miR-375	Microarray	20215506
MIRT025797	hsa-miR-7-5p	Sequencing	20371350
MIRT048535	hsa-miR-100-5p	CLASH	23622248
MIRT046315	hsa-miR-23b-3p	CLASH	23622248
MIRT041864	hsa-miR-484	CLASH	23622248
MIRT040747	hsa-miR-18a-3p	CLASH	23622248
MIRT036544	hsa-miR-1225-3p	CLASH	23622248
MIRT438052	hsa-miR-510-5p	Luciferase reporter assay, qRT-PCR, Western blot	23971998
MIRT438052	hsa-miR-510-5p	Luciferase reporter assay, qRT-PCR, Western blot	23971998
MIRT1260386	hsa-miR-3617	CLIP-seq
MIRT1260387	hsa-miR-4312	CLIP-seq
MIRT1260388	hsa-miR-4496	CLIP-seq
MIRT1260389	hsa-miR-4640-3p	CLIP-seq
MIRT1260390	hsa-miR-4763-5p	CLIP-seq
MIRT1260391	hsa-miR-641	CLIP-seq
MIRT1260392	hsa-miR-1280	CLIP-seq
MIRT1260393	hsa-miR-1972	CLIP-seq
MIRT1260394	hsa-miR-2117	CLIP-seq
MIRT1260395	hsa-miR-3685	CLIP-seq
MIRT1260396	hsa-miR-374c	CLIP-seq
MIRT1260397	hsa-miR-4273	CLIP-seq
MIRT1260398	hsa-miR-4293	CLIP-seq
MIRT1260399	hsa-miR-4650-5p	CLIP-seq
MIRT1260400	hsa-miR-4677-5p	CLIP-seq
MIRT1260390	hsa-miR-4763-5p	CLIP-seq
MIRT1260401	hsa-miR-485-3p	CLIP-seq
MIRT1260402	hsa-miR-487a	CLIP-seq
MIRT1260403	hsa-miR-499-3p	CLIP-seq
MIRT1260404	hsa-miR-499a-3p	CLIP-seq
MIRT1260405	hsa-miR-510	CLIP-seq
MIRT1260406	hsa-miR-596	CLIP-seq
MIRT1260407	hsa-miR-604	CLIP-seq
MIRT1260408	hsa-miR-647	CLIP-seq
MIRT1260409	hsa-miR-655	CLIP-seq
MIRT2076689	hsa-miR-1264	CLIP-seq
MIRT1260396	hsa-miR-374c	CLIP-seq
MIRT2076690	hsa-miR-3940-5p	CLIP-seq
MIRT2076691	hsa-miR-4264	CLIP-seq
MIRT2076692	hsa-miR-4277	CLIP-seq
MIRT2076693	hsa-miR-4506	CLIP-seq
MIRT2076694	hsa-miR-4507	CLIP-seq
MIRT2076695	hsa-miR-4797-3p	CLIP-seq
MIRT2076696	hsa-miR-581	CLIP-seq
MIRT1260409	hsa-miR-655	CLIP-seq
MIRT1260393	hsa-miR-1972	CLIP-seq
MIRT1260386	hsa-miR-3617	CLIP-seq
MIRT2599980	hsa-miR-3663-5p	CLIP-seq
MIRT1260395	hsa-miR-3685	CLIP-seq
MIRT1260396	hsa-miR-374c	CLIP-seq
MIRT1260398	hsa-miR-4293	CLIP-seq
MIRT1260387	hsa-miR-4312	CLIP-seq
MIRT1260388	hsa-miR-4496	CLIP-seq
MIRT1260389	hsa-miR-4640-3p	CLIP-seq
MIRT1260399	hsa-miR-4650-5p	CLIP-seq
MIRT1260390	hsa-miR-4763-5p	CLIP-seq
MIRT1260401	hsa-miR-485-3p	CLIP-seq
MIRT1260402	hsa-miR-487a	CLIP-seq
MIRT1260403	hsa-miR-499-3p	CLIP-seq
MIRT1260404	hsa-miR-499a-3p	CLIP-seq
MIRT1260405	hsa-miR-510	CLIP-seq
MIRT1260406	hsa-miR-596	CLIP-seq
MIRT1260391	hsa-miR-641	CLIP-seq
MIRT1260409	hsa-miR-655	CLIP-seq
MIRT1260393	hsa-miR-1972	CLIP-seq
MIRT1260386	hsa-miR-3617	CLIP-seq
MIRT2599980	hsa-miR-3663-5p	CLIP-seq
MIRT1260395	hsa-miR-3685	CLIP-seq
MIRT1260396	hsa-miR-374c	CLIP-seq
MIRT1260398	hsa-miR-4293	CLIP-seq
MIRT1260387	hsa-miR-4312	CLIP-seq
MIRT1260388	hsa-miR-4496	CLIP-seq
MIRT1260389	hsa-miR-4640-3p	CLIP-seq
MIRT1260399	hsa-miR-4650-5p	CLIP-seq
MIRT1260390	hsa-miR-4763-5p	CLIP-seq
MIRT1260401	hsa-miR-485-3p	CLIP-seq
MIRT1260402	hsa-miR-487a	CLIP-seq
MIRT1260403	hsa-miR-499-3p	CLIP-seq
MIRT1260404	hsa-miR-499a-3p	CLIP-seq
MIRT1260405	hsa-miR-510	CLIP-seq
MIRT1260406	hsa-miR-596	CLIP-seq
MIRT1260391	hsa-miR-641	CLIP-seq
MIRT1260409	hsa-miR-655	CLIP-seq

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0001501	Process	Skeletal system development	TAS	8089076
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004601	Function	Peroxidase activity	IDA	11986303
GO:0004601	Function	Peroxidase activity	IEA
GO:0004601	Function	Peroxidase activity	TAS
GO:0005515	Function	Protein binding	IPI	15105503, 17909037, 18172504, 19369943, 21044950, 21969592, 21988832, 23386615, 27607350, 28671123, 32814053, 33961781
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	17603937
GO:0005737	Component	Cytoplasm	IDA	17603937
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006979	Process	Response to oxidative stress	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IEA
GO:0008283	Process	Cell population proliferation	TAS	8089076
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	IDA	18606987
GO:0016209	Function	Antioxidant activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019430	Process	Removal of superoxide radicals	IBA
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0030101	Process	Natural killer cell activation	IDA	8462106
GO:0032872	Process	Regulation of stress-activated MAPK cascade	IEA
GO:0034101	Process	Erythrocyte homeostasis	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	11986303
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	18606987
GO:0042802	Function	Identical protein binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045321	Process	Leukocyte activation	IBA
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0051920	Function	Peroxiredoxin activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEA

MIM	HGNC	e!Ensembl
176763	9352	ENSG00000117450

Protein

UniProt ID

Q06830

Protein name

Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)

Protein function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog

PDB

2RII , 3HY2 , 4XCS , 7LJ1 , 7WET , 7WEU , 8X71 , 8X73 , 8Z54 , 8Z55 , 8Z56 , 8Z57 , 8Z58 , 9B7A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00578	AhpC-TSA	8 → 142	AhpC/TSA family	Domain
PF10417	1-cysPrx_C	162 → 197	C-terminal domain of 1-Cys peroxiredoxin	Domain

Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK

Sequence length

199

Interactions

View interactions

	KEGG		Reactome
	Peroxisome Cobalamin transport and metabolism Amoebiasis		Detoxification of Reactive Oxygen Species TP53 Regulates Metabolic Genes

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Methylmalonic acidemia with homocystinuria	methylmalonic aciduria and homocystinuria, cblc type, digenic	rs1379672870	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS

Show/Hide Text Mining Associations (80)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	23065574
Adenocarcinoma of Lung	Associate	37620336, 38213773
Adenoma	Associate	34409853
Altitude Sickness	Associate	39173139
Alzheimer Disease	Associate	33049317
Anemia Hemolytic	Associate	30521599
Aortic Aneurysm Abdominal	Stimulate	21273562
Astrocytoma	Associate	20307276
Autistic Disorder	Associate	22051046
beta Thalassemia	Associate	30521599
Brain Neoplasms	Associate	20307276
Breast Neoplasms	Stimulate	19566940
Breast Neoplasms	Associate	20631257, 25011585, 28398822, 31412312, 31559796, 40496857
Carcinogenesis	Associate	27259998
Carcinoma	Associate	25188299
Carcinoma Hepatocellular	Associate	16254121, 26478675, 33771165, 35705729, 37356603, 39457014
Carcinoma Mucoepidermoid	Associate	20113375
Carcinoma Non Small Cell Lung	Stimulate	23914992
Carcinoma Ovarian Epithelial	Stimulate	21980378
Carcinoma Pancreatic Ductal	Associate	25426613
Carcinoma Squamous Cell	Associate	17192052, 23065574, 24009050
Cerebral Infarction	Associate	27924073
Cholangiocarcinoma	Associate	22446018
Chronic Periodontitis	Associate	21975116
Colorectal Neoplasms	Associate	18549262, 29687844, 33712558, 35460420
Death	Associate	16210786, 26478675
Drug Related Side Effects and Adverse Reactions	Associate	26689287, 31412312
Endometriosis	Associate	32106990
Esophageal Squamous Cell Carcinoma	Associate	15986332, 21517111, 24009050
Farber Lipogranulomatosis	Associate	23065574
Fibrosarcoma	Inhibit	29908016
Fuchs' Endothelial Dystrophy	Inhibit	31901729
Gallbladder Neoplasms	Associate	23065574
Glioblastoma	Associate	24728830
Glioblastoma	Stimulate	37566013
Glioma	Associate	37031183
Granuloma	Associate	11828047
Hashimoto Disease	Associate	33916948
Hepatitis B	Associate	30567989
HIV Infections	Associate	12421812, 22114700
Hypoxia	Stimulate	19016754
Hypoxia	Associate	20113375
Inferior Wall Myocardial Infarction	Associate	27924073
Inflammation	Inhibit	27388124
Ischemia	Associate	27924073
Klatskin Tumor	Associate	26617696
Leukemia Myeloid Acute	Associate	30581529
Lung Injury	Associate	11828047
Lymphatic Metastasis	Stimulate	23065574, 23914992, 29656298
Lymphoma	Associate	26636537, 26752561
Lysosomal Storage Diseases	Associate	28413178
Metabolism Inborn Errors	Associate	34215320
Methylmalonic acidemia with homocystinuria	Associate	34215320
Neoplasm Metastasis	Associate	26617696, 27388124, 29656298, 31559796
Neoplasm Metastasis	Inhibit	29348788
Neoplasms	Associate	15986332, 18549262, 20113375, 20307276, 21458040, 26617696, 26689287, 27388124, 28398822, 29348788, 29656298, 30756364, 35440018, 36776920, 37620336
Neoplasms	Stimulate	23065574, 23914992, 26478675, 26636537
Neoplasms	Inhibit	29908016
Neoplasms Squamous Cell	Associate	31470801
Non alcoholic Fatty Liver Disease	Associate	21656912
Osteosarcoma	Inhibit	29908016
Ovarian Neoplasms	Associate	31559796
Pancreatic Neoplasms	Associate	25426613
Pemphigus	Stimulate	33868574
Periodontitis	Stimulate	21975116
Polycystic Ovary Syndrome	Associate	33964924
Pre Eclampsia	Associate	36587441
Precancerous Conditions	Associate	15986332
Preeclamptic toxemia	Stimulate	36587441
Prostatic Neoplasms	Associate	19737972, 21031435, 30981892
Radiation Injuries	Stimulate	16210786
Sarcoidosis	Associate	11828047
Small Cell Lung Carcinoma	Associate	35845940
Squamous Cell Carcinoma of Head and Neck	Associate	26159854, 29802697
Squamous Cell Carcinoma of Head and Neck	Stimulate	27259998
Stomach Neoplasms	Associate	29656298, 30886505, 32382548
Stroke	Stimulate	27924073
Telomeric 22q13 Monosomy Syndrome	Associate	28009281
Triple Negative Breast Neoplasms	Associate	37063429
Uterine Cervical Neoplasms	Associate	31470801

PRDX1 (peroxiredoxin 1)