NOX3 (NADPH oxidase 3)

Gene

• Entrez ID: 50508
• Gene name: NADPH oxidase 3
• Gene symbol: NOX3
• Synonyms (NCBI Gene): GP91-3, MOX-2
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have bee

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029921	hsa-miR-26b-5p	Microarray	19088304
MIRT1190249	hsa-miR-3192	CLIP-seq
MIRT1190250	hsa-miR-3670	CLIP-seq
MIRT1190251	hsa-miR-421	CLIP-seq
MIRT1190252	hsa-miR-4300	CLIP-seq
MIRT1190253	hsa-miR-4709-5p	CLIP-seq
MIRT1190254	hsa-miR-920	CLIP-seq
MIRT2055095	hsa-miR-1254	CLIP-seq
MIRT2055096	hsa-miR-192	CLIP-seq
MIRT2055097	hsa-miR-215	CLIP-seq
MIRT2055098	hsa-miR-3116	CLIP-seq
MIRT2055099	hsa-miR-3690	CLIP-seq
MIRT2055100	hsa-miR-378	CLIP-seq
MIRT2055101	hsa-miR-378b	CLIP-seq
MIRT2055102	hsa-miR-378c	CLIP-seq
MIRT2055103	hsa-miR-378d	CLIP-seq
MIRT2055104	hsa-miR-378e	CLIP-seq
MIRT2055105	hsa-miR-378f	CLIP-seq
MIRT2055106	hsa-miR-378h	CLIP-seq
MIRT2055107	hsa-miR-378i	CLIP-seq
MIRT2055108	hsa-miR-422a	CLIP-seq
MIRT2055109	hsa-miR-661	CLIP-seq
MIRT2055095	hsa-miR-1254	CLIP-seq
MIRT2055096	hsa-miR-192	CLIP-seq
MIRT2055097	hsa-miR-215	CLIP-seq
MIRT2055098	hsa-miR-3116	CLIP-seq
MIRT2055099	hsa-miR-3690	CLIP-seq
MIRT2055100	hsa-miR-378	CLIP-seq
MIRT2055101	hsa-miR-378b	CLIP-seq
MIRT2055102	hsa-miR-378c	CLIP-seq
MIRT2055103	hsa-miR-378d	CLIP-seq
MIRT2055104	hsa-miR-378e	CLIP-seq
MIRT2055105	hsa-miR-378f	CLIP-seq
MIRT2055106	hsa-miR-378h	CLIP-seq
MIRT2055107	hsa-miR-378i	CLIP-seq
MIRT2055108	hsa-miR-422a	CLIP-seq
MIRT2055109	hsa-miR-661	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001659	Process	Temperature homeostasis	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006952	Process	Defense response	IBA	21873635
GO:0009590	Process	Detection of gravity	IEA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA	21873635
GO:0042554	Process	Superoxide anion generation	IBA	21873635
GO:0043020	Component	NADPH oxidase complex	IBA	21873635
GO:0048840	Process	Otolith development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 607105
• HGNC: 7890
• e!Ensembl: ENSG00000074771

Protein

• UniProt ID: Q9HBY0
• Protein name: NADPH oxidase 3 (EC 1.6.3.-) (Mitogenic oxidase 2) (MOX-2) (gp91phox homolog 3) (GP91-3)
• Protein function: NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor, upon formation of a complex with CYBA/p22phox (PubMed:15181005, PubMed:15824103). Plays a role in the biogenesis of otoconia/ot
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01794	Ferric_reduct	55 → 218	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	290 → 393	FAD-binding domain	Domain
  PF08030	NAD_binding_6	399 → 549	Ferric reductase NAD binding domain	Domain

• Sequence:

  MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
  LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
  FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
  SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
  FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
  HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
  AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
  IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
  WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
  SRTLQKMCHLYSSADPRGVHFYYNKESF

• Sequence length: 568

Pathways

Reactome:

RHO GTPases Activate NADPH Oxidases

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29610475

Unknown
Disease term	Disease name	Evidence	References	Source
Dyslexia	Dyslexia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Carcinoma Non Small Cell Lung	Associate	30273693
Granulomatous Disease Chronic	Associate	36122532
Hearing Loss Noise Induced	Associate	32014026
Hyperparathyroidism	Associate	37854190
Hypertension Pulmonary	Associate	30290780
Primary Graft Dysfunction	Associate	25439478
Tinnitus	Associate	32014026