Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50506
Gene name Gene Name - the full gene name approved by the HGNC.	Dual oxidase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DUOX2
Synonyms (NCBI Gene) Gene synonyms aliases	LNOX2, NOXEF2, P138-TOX, TDH6, THOX2
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide tra

Show/Hide all(29)

SNP ID	Visualize variation	Clinical significance	Consequence
rs119472026	G>A,C	Pathogenic	Missense variant, coding sequence variant, stop gained
rs119472027	G>A	Pathogenic	Coding sequence variant, stop gained
rs119472028	G>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs119472029	G>A,T	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs139161034	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs180671269	T>A,C	Pathogenic	Missense variant, stop gained, coding sequence variant
rs181461079	C>A,T	Likely-pathogenic, likely-benign	Missense variant, coding sequence variant
rs191759494	C>G,T	Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs199589510	G>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, stop gained
rs199752932	A>G	Likely-pathogenic	Splice donor variant
rs200592893	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs368488511	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs375943962	C>A	Likely-pathogenic	Intron variant
rs376983373	C>A,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs377189285	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant, stop gained
rs530719719	ACGA>-	Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant
rs567500345	C>-,CC	Pathogenic-likely-pathogenic	Frameshift variant, coding sequence variant
rs748194265	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs748793969	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs751410726	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs752635135	C>G	Pathogenic	Splice donor variant
rs758000012	T>G	Likely-pathogenic	Splice acceptor variant
rs760031457	GGAGCTGAGAAAAAGAAA>-	Likely-pathogenic	Intron variant, splice acceptor variant, coding sequence variant
rs764517475	C>G	Pathogenic	Splice acceptor variant
rs771198569	G>C	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs775863038	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1566978577	ACCACGTC>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1595527456	->CTGAGAGCTTGGGAGCTTT	Pathogenic	Coding sequence variant, frameshift variant
rs1595529163	TC>-	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT640115	hsa-miR-513b-3p	HITS-CLIP	23824327
MIRT640114	hsa-miR-4661-3p	HITS-CLIP	23824327
MIRT640113	hsa-miR-105-5p	HITS-CLIP	23824327
MIRT640112	hsa-miR-7853-5p	HITS-CLIP	23824327
MIRT640111	hsa-miR-6847-5p	HITS-CLIP	23824327
MIRT640110	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT640109	hsa-miR-5193	HITS-CLIP	23824327
MIRT640108	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT640107	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT640106	hsa-miR-4469	HITS-CLIP	23824327
MIRT640105	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT640104	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT640103	hsa-miR-7977	HITS-CLIP	23824327
MIRT640102	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT640109	hsa-miR-5193	Immunohistochemistry (IHC), Western blotting	33748270
MIRT732625	hsa-miR-1343-3p	Immunohistochemistry (IHC), Western blotting	33748270
MIRT640115	hsa-miR-513b-3p	HITS-CLIP	23824327
MIRT640114	hsa-miR-4661-3p	HITS-CLIP	23824327
MIRT640113	hsa-miR-105-5p	HITS-CLIP	23824327
MIRT640112	hsa-miR-7853-5p	HITS-CLIP	23824327
MIRT640111	hsa-miR-6847-5p	HITS-CLIP	23824327
MIRT640110	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT640109	hsa-miR-5193	HITS-CLIP	23824327
MIRT640108	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT640107	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT640106	hsa-miR-4469	HITS-CLIP	23824327
MIRT640105	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT640104	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT640103	hsa-miR-7977	HITS-CLIP	23824327
MIRT640102	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT947281	hsa-miR-3134	CLIP-seq
MIRT947282	hsa-miR-342-5p	CLIP-seq
MIRT947283	hsa-miR-3688-3p	CLIP-seq
MIRT947284	hsa-miR-4314	CLIP-seq
MIRT947285	hsa-miR-4534	CLIP-seq
MIRT947286	hsa-miR-4651	CLIP-seq
MIRT947287	hsa-miR-4664-5p	CLIP-seq
MIRT947288	hsa-miR-4667-5p	CLIP-seq
MIRT947289	hsa-miR-4700-5p	CLIP-seq
MIRT947290	hsa-miR-608	CLIP-seq
MIRT947291	hsa-miR-637	CLIP-seq
MIRT1980590	hsa-miR-1255a	CLIP-seq
MIRT1980591	hsa-miR-1255b	CLIP-seq
MIRT947281	hsa-miR-3134	CLIP-seq
MIRT1980592	hsa-miR-329	CLIP-seq
MIRT947282	hsa-miR-342-5p	CLIP-seq
MIRT1980593	hsa-miR-362-3p	CLIP-seq
MIRT947283	hsa-miR-3688-3p	CLIP-seq
MIRT1980594	hsa-miR-3941	CLIP-seq
MIRT947284	hsa-miR-4314	CLIP-seq
MIRT947285	hsa-miR-4534	CLIP-seq
MIRT947286	hsa-miR-4651	CLIP-seq
MIRT947287	hsa-miR-4664-5p	CLIP-seq
MIRT947288	hsa-miR-4667-5p	CLIP-seq
MIRT947289	hsa-miR-4700-5p	CLIP-seq
MIRT1980595	hsa-miR-490-5p	CLIP-seq
MIRT1980596	hsa-miR-500a	CLIP-seq
MIRT1980597	hsa-miR-603	CLIP-seq
MIRT947290	hsa-miR-608	CLIP-seq
MIRT947291	hsa-miR-637	CLIP-seq
MIRT2215570	hsa-miR-1184	CLIP-seq
MIRT2215571	hsa-miR-1205	CLIP-seq
MIRT2215572	hsa-miR-2110	CLIP-seq
MIRT2215573	hsa-miR-3144-5p	CLIP-seq
MIRT2215574	hsa-miR-3150a-3p	CLIP-seq
MIRT2215575	hsa-miR-3158-5p	CLIP-seq
MIRT2215576	hsa-miR-3184	CLIP-seq
MIRT2215577	hsa-miR-3191	CLIP-seq
MIRT2215578	hsa-miR-3194-3p	CLIP-seq
MIRT2215579	hsa-miR-423-5p	CLIP-seq
MIRT2215580	hsa-miR-4260	CLIP-seq
MIRT2215581	hsa-miR-4267	CLIP-seq
MIRT2215582	hsa-miR-4283	CLIP-seq
MIRT2215583	hsa-miR-4290	CLIP-seq
MIRT2215584	hsa-miR-4652-5p	CLIP-seq
MIRT2215585	hsa-miR-4681	CLIP-seq
MIRT2215586	hsa-miR-4687-5p	CLIP-seq
MIRT2215587	hsa-miR-4747-5p	CLIP-seq
MIRT2215588	hsa-miR-510	CLIP-seq
MIRT2215589	hsa-miR-512-5p	CLIP-seq
MIRT2215590	hsa-miR-760	CLIP-seq
MIRT2215591	hsa-miR-766	CLIP-seq
MIRT2448603	hsa-miR-3190	CLIP-seq
MIRT2448604	hsa-miR-4461	CLIP-seq
MIRT2448605	hsa-miR-4752	CLIP-seq
MIRT2448606	hsa-miR-581	CLIP-seq
MIRT2448607	hsa-miR-7	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	15972824
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	19339556, 25761904
GO:0005783	Component	Endoplasmic reticulum	IDA	19339556
GO:0005829	Component	Cytosol	IDA	19339556
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19339556
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IGI	16651268, 25761904
GO:0005886	Component	Plasma membrane	TAS
GO:0006590	Process	Thyroid hormone generation	IEA
GO:0006590	Process	Thyroid hormone generation	TAS
GO:0006952	Process	Defense response	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009615	Process	Response to virus	IDA	16111680
GO:0009986	Component	Cell surface	IGI	22814254
GO:0016020	Component	Membrane	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IDA	15972824
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IEA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IMP	21565790
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	TAS
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	16111680
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0020037	Function	Heme binding	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0031252	Component	Cell leading edge	IGI	19339556
GO:0042335	Process	Cuticle development	ISS
GO:0042446	Process	Hormone biosynthetic process	IEA
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IGI	22814254
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0045177	Component	Apical part of cell	IDA	25761904
GO:0046872	Function	Metal ion binding	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IGI	16651268, 19339556, 22814254, 25761904
GO:0051591	Process	Response to cAMP	IDA	15062544
GO:0051591	Process	Response to cAMP	IEA
GO:0051591	Process	Response to cAMP	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070161	Component	Anchoring junction	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0090303	Process	Positive regulation of wound healing	IEA
GO:0090303	Process	Positive regulation of wound healing	IGI	19339556
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:2000147	Process	Positive regulation of cell motility	IGI	19339556

MIM	HGNC	e!Ensembl
606759	13273	ENSG00000140279

Protein

UniProt ID

Q9NRD8

Protein name

Dual oxidase 2 (EC 1.11.1.-) (EC 1.6.3.1) (Large NOX 2) (Long NOX 2) (NADH/NADPH thyroid oxidase p138-tox) (NADPH oxidase/peroxidase DUOX2) (NADPH thyroid oxidase 2) (Thyroid oxidase 2) (p138 thyroid oxidase)

Protein function

Generates hydrogen peroxide which is required for the activity of thyroid peroxidase/TPO and lactoperoxidase/LPO. Plays a role in thyroid hormones synthesis and lactoperoxidase-mediated antimicrobial defense at the surface of mucosa. May have it

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03098	An_peroxidase	35 → 560	Animal haem peroxidase	Domain
PF00036	EF-hand_1	823 → 851	EF hand	Domain
PF01794	Ferric_reduct	1084 → 1233	Ferric reductase like transmembrane component	Family
PF08022	FAD_binding_8	1269 → 1371	FAD-binding domain	Domain
PF08030	NAD_binding_6	1377 → 1531	Ferric reductase NAD binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in colon, small intestine, duodenum and tracheal surface epithelial cells (at protein level). Expressed in thyrocytes. Also detected in kidney, liver, lung, pancreas, prostate, salivary glands, rectum and testis. {ECO:0000269

Sequence

MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRR
VPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVE
TPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLD
GSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYE
WLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKG
FQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLS
QLELLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTL
RDVLVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAI
TIIALCCLPLVSLLLSGVVAYFRGREHKKLQKKLKESVKKEAAKDGVPAMEWPGPKERSS
PIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNNRGCRTLLLKIPKEYDLVLLF
SSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVL
DINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQL
AEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNI
SCRVSFITRTPGERSHPQGLGPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQ
RGFLAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGI
ILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAIL
HSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLA
IMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTL
TSAPHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVS
VLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEEND
HQDLVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFN
SLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF

Sequence length

1548

Interactions

View interactions

	KEGG		Reactome
	Thyroid hormone synthesis		Thyroxine biosynthesis

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Congenital Hypothyroidism	congenital hypothyroidism	rs530719719, rs567500345	N/A
Thyroid Dyshormonogenesis	thyroid dyshormonogenesis 6	rs748793969, rs119472028, rs754179275, rs119472029, rs368975704, rs200592893, rs530719719, rs1566977567, rs199589510, rs1566978577, rs191759494, rs752635135, rs567500345, rs376983373, rs180671269, rs119472026, rs748194265, rs119472027 View all (3 more)	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Meckel Syndrome	meckel syndrome, type 11	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (87)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Associate	33628596
Adenomatous Polyposis Coli	Associate	33628596
Alcoholism	Associate	36577732
Anemia Sickle Cell	Associate	21114906
Angelman Syndrome	Associate	36028527
Asthma	Associate	24518246
Atherosclerosis	Associate	33851807
Autism Spectrum Disorder	Associate	31595719
Carcinogenesis	Associate	21915726
Carcinoma Hepatocellular	Associate	21915726, 27282266
Carcinoma in Situ	Associate	32425884
Carcinoma Non Small Cell Lung	Associate	30273693
Carcinoma Pancreatic Ductal	Associate	37330147
Cardiomyopathy Dilated	Associate	29320567
Cognition Disorders	Associate	32815446
Colitis Collagenous	Associate	33930606
Colitis Ulcerative	Stimulate	25003194
Colitis Ulcerative	Associate	25599773, 32190668, 37322958, 38070204, 38269750
Colorectal Neoplasms	Associate	27609023, 29715584, 31992345, 33483567
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28222800
Congenital Hypothyroidism	Associate	12110737, 19339556, 21367925, 23426615, 26709262, 26758695, 28541007, 28633507, 29650690, 29977049, 30022773, 30375286, 31044655, 32425884, 34200080 View all (10 more)
Constriction Pathologic	Associate	38302662
Coronary Artery Disease	Associate	19022160
Crohn Disease	Associate	20155851, 25003194, 27373512
Cystic Fibrosis	Associate	21289024
Diabetes Mellitus	Associate	15086456, 22421922
Diabetes Mellitus Type 2	Associate	23701472, 33851807
Diabetes Mellitus Type 2	Inhibit	39948776
Dupuytren Contracture	Associate	29880057
Dyskinesia Drug Induced	Associate	40516894
Essential Hypertension	Associate	23701472
Familial medullary thyroid carcinoma	Associate	33488516
Gastritis	Associate	34471638
Gastrointestinal Neoplasms	Associate	21321110, 31548328
Genetic Diseases Inborn	Associate	28541007, 30022773
Goiter	Associate	18042646, 28222800, 30375286
Granulomatous Disease Chronic	Associate	11166463, 19541821, 21721378, 23264412, 25537876, 25666294, 28287132, 28356734, 35500221, 36705996, 36875143, 7919388, 7949143, 8611697, 8879195
Granulomatous Disease Chronic Autosomal Recessive Cytochrome B Positive Type I	Associate	7919388
Heart Failure	Associate	18387435
Helicobacter Infections	Inhibit	27048452
Hypertension	Associate	22421922
Hypothyroidism	Associate	21704604, 31044655, 31541602, 32319661, 34341225, 36207837
Hypothyroidism Congenital Nongoitrous 1	Associate	32319661
Hypothyroidism Congenital Nongoitrous 2	Associate	27821020
Hypoxia	Associate	27624778
Infections	Associate	20395558, 27048452
Inflammation	Associate	21321110, 31548328, 32190668, 38070204
Inflammatory Bowel Diseases	Associate	29977049
Intestinal Polyposis	Associate	33628596
Invasive Pulmonary Aspergillosis	Associate	19541821
Leukemia	Associate	20566897
Liver Diseases	Associate	27282266
Lung Diseases	Associate	19339556
Lung Neoplasms	Associate	19339556
Lymphoma B Cell	Associate	22354003
Metabolic Syndrome	Associate	22421922
Mucositis	Associate	25003194
Multiple Myeloma	Associate	36223594
Multiple Sclerosis	Associate	22366799
Neoplasm Metastasis	Associate	34966441
Neoplasms	Associate	21915726
Neoplastic Syndromes Hereditary	Associate	15629370, 28287132, 33488516
Obesity	Associate	22421922
Overweight	Associate	22421922
Pancreatic Neoplasms	Associate	21321110, 31548328, 33748270, 37330147
Pendred syndrome	Associate	28222800
Phenylketonurias	Associate	36847978, 38105685
Psychomotor Disorders	Associate	30375286
Pulmonary Arterial Hypertension	Associate	23701472
Rectal Neoplasms	Associate	36361712
Severe Acute Respiratory Syndrome	Associate	24518246
Squamous Cell Carcinoma of Head and Neck	Associate	29802697
Stomach Neoplasms	Associate	26207686, 27048452
Thyroid cancer medullary	Associate	33488516
Thyroid Carcinoma Anaplastic	Associate	27796151
Thyroid Diseases	Associate	28222800
Thyroid Dysgenesis	Associate	32425884
Thyroid Dyshormonogenesis 1	Associate	27525530, 27821020, 30022773, 30240412, 31541602, 32319661, 33692749, 34341225, 36012511
Thyroid Dyshormonogenesis 1	Stimulate	34539567
Thyroid Dyshormonogenesis 2A	Associate	12110737
Thyroid Hormone Resistance Syndrome	Associate	12110737, 34341225
Thyroid Neoplasms	Associate	34966441
Thyroiditis	Associate	36207832
Uniparental Disomy	Associate	36028527
Uterine Cervical Neoplasms	Stimulate	31706280
Vascular Diseases	Associate	18387435
Ventricular Remodeling	Associate	29320567

DUOX2 (dual oxidase 2)