Gene Gene information from NCBI Gene database.
Entrez ID 50487
Gene name Phospholipase A2 group III
Gene symbol PLA2G3
Synonyms (NCBI Gene)
GIII-SPLA2SPLA2IIIsPLA2-III
Chromosome 22
Chromosome location 22q12.2
Summary This gene encodes a protein that belongs to the secreted phospholipase A2 family, whose members include the bee venom enzyme. The encoded enzyme functions in lipid metabolism and catalyzes the calcium-dependent hydrolysis of the sn-2 acyl bond of phosphol
miRNA miRNA information provided by mirtarbase database.
48
miRTarBase ID miRNA Experiments Reference
MIRT1238683 hsa-let-7a CLIP-seq
MIRT1238684 hsa-let-7b CLIP-seq
MIRT1238685 hsa-let-7c CLIP-seq
MIRT1238686 hsa-let-7d CLIP-seq
MIRT1238687 hsa-let-7e CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0001675 Process Acrosome assembly IEA
GO:0002532 Process Production of molecular mediator involved in inflammatory response IEA
GO:0004620 Function Phospholipase activity IEA
GO:0004623 Function Phospholipase A2 activity IEA
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611651 17934 ENSG00000100078
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZ20
Protein name Group 3 secretory phospholipase A2 (EC 3.1.1.4) (Group III secretory phospholipase A2) (GIII sPLA2) (sPLA2-III) (Phosphatidylcholine 2-acylhydrolase 3)
Protein function Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids without apparent head group selectivity (PubMed:1252210
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05826 Phospholip_A2_2 152 248 Phospholipase A2 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, heart, liver, and skeletal muscle. Also present in placenta and peripheral blood leukocytes. Not detected in colon, thymus, spleen and small intestine. In lung, expressed in bronchial epithelial cells and alveolar
Sequence
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLE
EQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
Sequence length 509
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
  Acyl chain remodelling of PC
Acyl chain remodelling of PE
Acyl chain remodelling of PG