Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5045
Gene name Gene Name - the full gene name approved by the HGNC.	Furin, paired basic amino acid cleaving enzyme
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FURIN
Synonyms (NCBI Gene) Gene synonyms aliases	FUR, PACE, PCSK3, SPC1
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q26.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membr

Show/Hide all(294)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005919	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20945401
MIRT027060	hsa-miR-103a-3p	Sequencing	20371350
MIRT031785	hsa-miR-16-5p	Sequencing	20371350
MIRT042240	hsa-miR-484	CLASH	23622248
MIRT039979	hsa-miR-615-3p	CLASH	23622248
MIRT005919	hsa-miR-24-3p	qRT-PCR, Western blot	22260784
MIRT476700	hsa-miR-107	PAR-CLIP	23592263
MIRT027060	hsa-miR-103a-3p	PAR-CLIP	23592263
MIRT031785	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT476699	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT476698	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT476697	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT476696	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT476695	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT476694	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT476693	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT476692	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT476691	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT476690	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT476689	hsa-miR-4286	PAR-CLIP	23592263
MIRT476688	hsa-miR-6089	PAR-CLIP	23592263
MIRT476686	hsa-miR-4505	PAR-CLIP	23592263
MIRT476687	hsa-miR-5787	PAR-CLIP	23592263
MIRT476685	hsa-miR-3153	PAR-CLIP	23592263
MIRT476684	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT476683	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT476682	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT476681	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT476680	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT476679	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT476678	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT027060	hsa-miR-103a-3p	PAR-CLIP	26701625
MIRT476700	hsa-miR-107	PAR-CLIP	26701625
MIRT476679	hsa-miR-1233-5p	PAR-CLIP	26701625
MIRT476693	hsa-miR-140-3p	PAR-CLIP	26701625
MIRT476698	hsa-miR-15a-5p	PAR-CLIP	26701625
MIRT476699	hsa-miR-15b-5p	PAR-CLIP	26701625
MIRT031785	hsa-miR-16-5p	PAR-CLIP	26701625
MIRT476697	hsa-miR-195-5p	PAR-CLIP	26701625
MIRT476685	hsa-miR-3153	PAR-CLIP	26701625
MIRT476696	hsa-miR-424-5p	PAR-CLIP	26701625
MIRT476689	hsa-miR-4286	PAR-CLIP	26701625
MIRT476686	hsa-miR-4505	PAR-CLIP	26701625
MIRT476695	hsa-miR-497-5p	PAR-CLIP	26701625
MIRT476687	hsa-miR-5787	PAR-CLIP	26701625
MIRT476688	hsa-miR-6089	PAR-CLIP	26701625
MIRT476682	hsa-miR-6508-3p	PAR-CLIP	26701625
MIRT476684	hsa-miR-6733-5p	PAR-CLIP	26701625
MIRT476683	hsa-miR-6739-5p	PAR-CLIP	26701625
MIRT476681	hsa-miR-6756-5p	PAR-CLIP	26701625
MIRT476692	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT476680	hsa-miR-6766-5p	PAR-CLIP	26701625
MIRT476678	hsa-miR-6778-5p	PAR-CLIP	26701625
MIRT476690	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT476694	hsa-miR-6838-5p	PAR-CLIP	26701625
MIRT476691	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT476700	hsa-miR-107	PAR-CLIP	23592263
MIRT027060	hsa-miR-103a-3p	PAR-CLIP	23592263
MIRT031785	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT476699	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT476698	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT476697	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT476696	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT476695	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT476694	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT476693	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT476692	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT476691	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT476690	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT476689	hsa-miR-4286	PAR-CLIP	23592263
MIRT476688	hsa-miR-6089	PAR-CLIP	23592263
MIRT476686	hsa-miR-4505	PAR-CLIP	23592263
MIRT476687	hsa-miR-5787	PAR-CLIP	23592263
MIRT476685	hsa-miR-3153	PAR-CLIP	23592263
MIRT476684	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT476683	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT476682	hsa-miR-6508-3p	PAR-CLIP	23592263
MIRT476681	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT476680	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT476679	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT476678	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT1006206	hsa-miR-103a	CLIP-seq
MIRT1006207	hsa-miR-106a	CLIP-seq
MIRT1006208	hsa-miR-106b	CLIP-seq
MIRT1006209	hsa-miR-1224-3p	CLIP-seq
MIRT1006210	hsa-miR-1227	CLIP-seq
MIRT1006211	hsa-miR-1234	CLIP-seq
MIRT1006212	hsa-miR-124	CLIP-seq
MIRT1006213	hsa-miR-1275	CLIP-seq
MIRT1006214	hsa-miR-128	CLIP-seq
MIRT1006215	hsa-miR-148a	CLIP-seq
MIRT1006216	hsa-miR-148b	CLIP-seq
MIRT1006217	hsa-miR-152	CLIP-seq
MIRT1006218	hsa-miR-153	CLIP-seq
MIRT1006219	hsa-miR-15a	CLIP-seq
MIRT1006220	hsa-miR-15b	CLIP-seq
MIRT1006221	hsa-miR-16	CLIP-seq
MIRT1006222	hsa-miR-17	CLIP-seq
MIRT1006223	hsa-miR-195	CLIP-seq
MIRT1006224	hsa-miR-19a	CLIP-seq
MIRT1006225	hsa-miR-19b	CLIP-seq
MIRT1006226	hsa-miR-20a	CLIP-seq
MIRT1006227	hsa-miR-20b	CLIP-seq
MIRT1006228	hsa-miR-219-5p	CLIP-seq
MIRT1006229	hsa-miR-2355-3p	CLIP-seq
MIRT1006230	hsa-miR-24	CLIP-seq
MIRT1006231	hsa-miR-2861	CLIP-seq
MIRT1006232	hsa-miR-3128	CLIP-seq
MIRT1006233	hsa-miR-3130-3p	CLIP-seq
MIRT1006234	hsa-miR-3132	CLIP-seq
MIRT1006235	hsa-miR-3143	CLIP-seq
MIRT1006236	hsa-miR-3147	CLIP-seq
MIRT1006237	hsa-miR-3157-5p	CLIP-seq
MIRT1006238	hsa-miR-3179	CLIP-seq
MIRT1006239	hsa-miR-3199	CLIP-seq
MIRT1006240	hsa-miR-3202	CLIP-seq
MIRT1006241	hsa-miR-342-5p	CLIP-seq
MIRT1006242	hsa-miR-34b	CLIP-seq
MIRT1006243	hsa-miR-3609	CLIP-seq
MIRT1006244	hsa-miR-3614-5p	CLIP-seq
MIRT1006245	hsa-miR-3622a-5p	CLIP-seq
MIRT1006246	hsa-miR-3647-3p	CLIP-seq
MIRT1006247	hsa-miR-3908	CLIP-seq
MIRT1006248	hsa-miR-3936	CLIP-seq
MIRT1006249	hsa-miR-424	CLIP-seq
MIRT1006250	hsa-miR-4283	CLIP-seq
MIRT1006251	hsa-miR-4310	CLIP-seq
MIRT1006252	hsa-miR-4425	CLIP-seq
MIRT1006253	hsa-miR-4437	CLIP-seq
MIRT1006254	hsa-miR-4445	CLIP-seq
MIRT1006255	hsa-miR-4464	CLIP-seq
MIRT1006256	hsa-miR-448	CLIP-seq
MIRT1006257	hsa-miR-4506	CLIP-seq
MIRT1006258	hsa-miR-4509	CLIP-seq
MIRT1006259	hsa-miR-4533	CLIP-seq
MIRT1006260	hsa-miR-4650-3p	CLIP-seq
MIRT1006261	hsa-miR-4652-5p	CLIP-seq
MIRT1006262	hsa-miR-4663	CLIP-seq
MIRT1006263	hsa-miR-4664-5p	CLIP-seq
MIRT1006264	hsa-miR-4665-3p	CLIP-seq
MIRT1006265	hsa-miR-4665-5p	CLIP-seq
MIRT1006266	hsa-miR-4685-5p	CLIP-seq
MIRT1006267	hsa-miR-4691-3p	CLIP-seq
MIRT1006268	hsa-miR-4715-3p	CLIP-seq
MIRT1006269	hsa-miR-4717-3p	CLIP-seq
MIRT1006270	hsa-miR-4719	CLIP-seq
MIRT1006271	hsa-miR-4720-5p	CLIP-seq
MIRT1006272	hsa-miR-4731-5p	CLIP-seq
MIRT1006273	hsa-miR-4733-3p	CLIP-seq
MIRT1006274	hsa-miR-4740-5p	CLIP-seq
MIRT1006275	hsa-miR-4744	CLIP-seq
MIRT1006276	hsa-miR-4748	CLIP-seq
MIRT1006277	hsa-miR-4782-3p	CLIP-seq
MIRT1006278	hsa-miR-4793-3p	CLIP-seq
MIRT1006279	hsa-miR-4796-3p	CLIP-seq
MIRT1006280	hsa-miR-4799-3p	CLIP-seq
MIRT1006281	hsa-miR-4802-3p	CLIP-seq
MIRT1006282	hsa-miR-497	CLIP-seq
MIRT1006283	hsa-miR-506	CLIP-seq
MIRT1006284	hsa-miR-508-3p	CLIP-seq
MIRT1006285	hsa-miR-519d	CLIP-seq
MIRT1006286	hsa-miR-520g	CLIP-seq
MIRT1006287	hsa-miR-520h	CLIP-seq
MIRT1006288	hsa-miR-543	CLIP-seq
MIRT1006289	hsa-miR-548aa	CLIP-seq
MIRT1006290	hsa-miR-548ah	CLIP-seq
MIRT1006291	hsa-miR-548an	CLIP-seq
MIRT1006292	hsa-miR-634	CLIP-seq
MIRT1006293	hsa-miR-647	CLIP-seq
MIRT1006294	hsa-miR-676	CLIP-seq
MIRT1006295	hsa-miR-890	CLIP-seq
MIRT1006296	hsa-miR-93	CLIP-seq
MIRT1006207	hsa-miR-106a	CLIP-seq
MIRT1006208	hsa-miR-106b	CLIP-seq
MIRT1998174	hsa-miR-1207-5p	CLIP-seq
MIRT1006211	hsa-miR-1234	CLIP-seq
MIRT1998175	hsa-miR-125a-5p	CLIP-seq
MIRT1998176	hsa-miR-125b	CLIP-seq
MIRT1998177	hsa-miR-1270	CLIP-seq
MIRT1006214	hsa-miR-128	CLIP-seq
MIRT1998178	hsa-miR-1293	CLIP-seq
MIRT1006215	hsa-miR-148a	CLIP-seq
MIRT1006216	hsa-miR-148b	CLIP-seq
MIRT1006217	hsa-miR-152	CLIP-seq
MIRT1006222	hsa-miR-17	CLIP-seq
MIRT1998179	hsa-miR-185	CLIP-seq
MIRT1998180	hsa-miR-1909	CLIP-seq
MIRT1006226	hsa-miR-20a	CLIP-seq
MIRT1006227	hsa-miR-20b	CLIP-seq
MIRT1006230	hsa-miR-24	CLIP-seq
MIRT1998181	hsa-miR-3160-5p	CLIP-seq
MIRT1998182	hsa-miR-3173-3p	CLIP-seq
MIRT1998183	hsa-miR-323-5p	CLIP-seq
MIRT1006242	hsa-miR-34b	CLIP-seq
MIRT1006243	hsa-miR-3609	CLIP-seq
MIRT1998184	hsa-miR-3616-3p	CLIP-seq
MIRT1006246	hsa-miR-3647-3p	CLIP-seq
MIRT1998185	hsa-miR-371-5p	CLIP-seq
MIRT1998186	hsa-miR-371b-3p	CLIP-seq
MIRT1998187	hsa-miR-3940-3p	CLIP-seq
MIRT1998188	hsa-miR-4306	CLIP-seq
MIRT1998189	hsa-miR-4319	CLIP-seq
MIRT1998190	hsa-miR-432	CLIP-seq
MIRT1998191	hsa-miR-4324	CLIP-seq
MIRT1998192	hsa-miR-4436b-3p	CLIP-seq
MIRT1006253	hsa-miR-4437	CLIP-seq
MIRT1998193	hsa-miR-4483	CLIP-seq
MIRT1998194	hsa-miR-4492	CLIP-seq
MIRT1998195	hsa-miR-4498	CLIP-seq
MIRT1998196	hsa-miR-4514	CLIP-seq
MIRT1998197	hsa-miR-4525	CLIP-seq
MIRT1998198	hsa-miR-4531	CLIP-seq
MIRT1998199	hsa-miR-4644	CLIP-seq
MIRT1998200	hsa-miR-4645-5p	CLIP-seq
MIRT1998201	hsa-miR-4673	CLIP-seq
MIRT1006266	hsa-miR-4685-5p	CLIP-seq
MIRT1998202	hsa-miR-4690-3p	CLIP-seq
MIRT1998203	hsa-miR-4692	CLIP-seq
MIRT1998204	hsa-miR-4696	CLIP-seq
MIRT1998205	hsa-miR-4701-5p	CLIP-seq
MIRT1998206	hsa-miR-4716-3p	CLIP-seq
MIRT1006270	hsa-miR-4719	CLIP-seq
MIRT1006273	hsa-miR-4733-3p	CLIP-seq
MIRT1998207	hsa-miR-4733-5p	CLIP-seq
MIRT1998208	hsa-miR-4749-3p	CLIP-seq
MIRT1998209	hsa-miR-4763-3p	CLIP-seq
MIRT1006279	hsa-miR-4796-3p	CLIP-seq
MIRT1998210	hsa-miR-515-5p	CLIP-seq
MIRT1006285	hsa-miR-519d	CLIP-seq
MIRT1998211	hsa-miR-520f	CLIP-seq
MIRT1006286	hsa-miR-520g	CLIP-seq
MIRT1006287	hsa-miR-520h	CLIP-seq
MIRT1006289	hsa-miR-548aa	CLIP-seq
MIRT1006290	hsa-miR-548ah	CLIP-seq
MIRT1998212	hsa-miR-548t	CLIP-seq
MIRT1998213	hsa-miR-588	CLIP-seq
MIRT1998214	hsa-miR-604	CLIP-seq
MIRT1998215	hsa-miR-620	CLIP-seq
MIRT1006293	hsa-miR-647	CLIP-seq
MIRT1998216	hsa-miR-661	CLIP-seq
MIRT1998217	hsa-miR-762	CLIP-seq
MIRT1998218	hsa-miR-873	CLIP-seq
MIRT1006296	hsa-miR-93	CLIP-seq
MIRT1006230	hsa-miR-24	CLIP-seq
MIRT1006237	hsa-miR-3157-5p	CLIP-seq
MIRT1006250	hsa-miR-4283	CLIP-seq
MIRT1006253	hsa-miR-4437	CLIP-seq
MIRT1006266	hsa-miR-4685-5p	CLIP-seq
MIRT1006267	hsa-miR-4691-3p	CLIP-seq
MIRT1998207	hsa-miR-4733-5p	CLIP-seq
MIRT1998218	hsa-miR-873	CLIP-seq
MIRT2388245	hsa-miR-3652	CLIP-seq
MIRT2388246	hsa-miR-4430	CLIP-seq
MIRT2388247	hsa-miR-4436a	CLIP-seq
MIRT1006206	hsa-miR-103a	CLIP-seq
MIRT2437326	hsa-miR-1228	CLIP-seq
MIRT1998175	hsa-miR-125a-5p	CLIP-seq
MIRT1998176	hsa-miR-125b	CLIP-seq
MIRT1006219	hsa-miR-15a	CLIP-seq
MIRT1006220	hsa-miR-15b	CLIP-seq
MIRT1006221	hsa-miR-16	CLIP-seq
MIRT2437327	hsa-miR-1915	CLIP-seq
MIRT1006223	hsa-miR-195	CLIP-seq
MIRT2437328	hsa-miR-3165	CLIP-seq
MIRT1998183	hsa-miR-323-5p	CLIP-seq
MIRT1006249	hsa-miR-424	CLIP-seq
MIRT1006250	hsa-miR-4283	CLIP-seq
MIRT1998189	hsa-miR-4319	CLIP-seq
MIRT1998191	hsa-miR-4324	CLIP-seq
MIRT2437329	hsa-miR-4677-3p	CLIP-seq
MIRT2437330	hsa-miR-4679	CLIP-seq
MIRT1998208	hsa-miR-4749-3p	CLIP-seq
MIRT1006282	hsa-miR-497	CLIP-seq
MIRT2437331	hsa-miR-876-3p	CLIP-seq
MIRT1998177	hsa-miR-1270	CLIP-seq
MIRT1998179	hsa-miR-185	CLIP-seq
MIRT2535843	hsa-miR-192	CLIP-seq
MIRT2535844	hsa-miR-215	CLIP-seq
MIRT1006244	hsa-miR-3614-5p	CLIP-seq
MIRT1998188	hsa-miR-4306	CLIP-seq
MIRT1998190	hsa-miR-432	CLIP-seq
MIRT1998198	hsa-miR-4531	CLIP-seq
MIRT1998199	hsa-miR-4644	CLIP-seq
MIRT2535845	hsa-miR-4676-5p	CLIP-seq
MIRT2535846	hsa-miR-575	CLIP-seq
MIRT1998215	hsa-miR-620	CLIP-seq
MIRT1006295	hsa-miR-890	CLIP-seq
MIRT2437326	hsa-miR-1228	CLIP-seq
MIRT2681228	hsa-miR-1266	CLIP-seq
MIRT2681229	hsa-miR-3127-5p	CLIP-seq
MIRT2681230	hsa-miR-3918	CLIP-seq
MIRT1998192	hsa-miR-4436b-3p	CLIP-seq
MIRT2681231	hsa-miR-4518	CLIP-seq
MIRT1006266	hsa-miR-4685-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CEBPB	Activation	8132667
GATA1	Unknown	12411321

Show/Hide all(89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IMP	9130696, 11799113
GO:0000139	Component	Golgi membrane	TAS
GO:0001825	Process	Blastocyst formation	IEA
GO:0002020	Function	Protease binding	IPI	14744861
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0004175	Function	Endopeptidase activity	IDA	9242664, 17010968, 31091448
GO:0004175	Function	Endopeptidase activity	IMP	20489134
GO:0004175	Function	Endopeptidase activity	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IDA	1438214, 1644824, 7737999, 8615794, 10567353, 21763278
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IMP	9130696, 11799113
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	10567353
GO:0005515	Function	Protein binding	IPI	20608975, 21152186, 23829672, 25543063, 32512386, 32703818, 32814053, 33037310, 33043282, 33417835
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	10567353
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IGI	17938254
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	14744861
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006465	Process	Signal peptide processing	IDA	16912035
GO:0006465	Process	Signal peptide processing	IEA
GO:0006465	Process	Signal peptide processing	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0008201	Function	Heparin binding	IDA	34699015
GO:0008201	Function	Heparin binding	IEA
GO:0008233	Function	Peptidase activity	IDA	10526337, 15082773, 15606899, 17938254
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	9325052
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IDA	16537537
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016485	Process	Protein processing	IDA	15606899
GO:0016485	Process	Protein processing	IDA	9242664, 10526337, 10567353, 14744861, 17938254
GO:0016485	Process	Protein processing	IEA
GO:0016485	Process	Protein processing	IEA
GO:0016485	Process	Protein processing	IMP	15899807
GO:0016486	Process	Peptide hormone processing	IBA
GO:0016486	Process	Peptide hormone processing	IDA	9242664
GO:0016787	Function	Hydrolase activity	IEA
GO:0019058	Process	Viral life cycle	IEP	8940009
GO:0019081	Process	Viral translation	TAS	27384577
GO:0019082	Process	Viral protein processing	TAS
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030140	Component	Trans-Golgi network transport vesicle	IDA	15078902
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031090	Component	Organelle membrane	IEA
GO:0031638	Process	Zymogen activation	IMP	9130696, 11799113
GO:0032374	Process	Regulation of cholesterol transport	IEA
GO:0032804	Process	Negative regulation of low-density lipoprotein particle receptor catabolic process	IDA	16912035
GO:0032902	Process	Nerve growth factor production	IDA	8615794
GO:0032904	Process	Negative regulation of nerve growth factor production	IDA	10567353
GO:0032911	Process	Negative regulation of transforming growth factor beta1 production	IMP	15899807
GO:0032940	Process	Secretion by cell	IDA	8615794
GO:0034369	Process	Plasma lipoprotein particle remodeling	TAS
GO:0042176	Process	Regulation of protein catabolic process	IMP	15899807
GO:0042277	Function	Peptide binding	IDA	8940009
GO:0043043	Process	Peptide biosynthetic process	IDA	8262946
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	32362314
GO:0046718	Process	Symbiont entry into host cell	IDA	9641677
GO:0046872	Function	Metal ion binding	IEA
GO:0048406	Function	Nerve growth factor binding	IDA	8615794
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IC	17010968
GO:0051604	Process	Protein maturation	IDA	31091448
GO:0051604	Process	Protein maturation	IEA
GO:0061133	Function	Endopeptidase activator activity	IDA	14744861
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0090472	Process	Dibasic protein processing	IMP	11799113
GO:0097341	Process	Zymogen inhibition	IMP	9130696, 11799113
GO:0098791	Component	Golgi apparatus subcompartment	IEA
GO:0140447	Process	Cytokine precursor processing	IDA	7737999
GO:1904399	Function	Heparan sulfate binding	IDA	34699015
GO:1990000	Process	Amyloid fibril formation	TAS

MIM	HGNC	e!Ensembl
136950	8568	ENSG00000140564

Protein

UniProt ID

P09958

Protein name

Furin (EC 3.4.21.75) (Dibasic-processing enzyme) (Paired basic amino acid residue-cleaving enzyme) (PACE)

Protein function

Ubiquitous endoprotease within constitutive secretory pathways capable of cleavage at the RX(K/R)R consensus motif (PubMed:11799113, PubMed:1629222, PubMed:1713771, PubMed:2251280, PubMed:24666235, PubMed:25974265, PubMed:7592877, PubMed:7690548

PDB

4OMC , 4OMD , 4RYD , 4Z2A , 5JMO , 5JXG , 5JXH , 5JXI , 5JXJ , 5MIM , 6A8Y , 6EQV , 6EQW , 6EQX , 6HLB , 6HLD , 6HLE , 6HZA , 6HZB , 6HZC , 6HZD , 6YD2 , 6YD3 , 6YD4 , 6YD7 , 7LCU , 7O1U , 7O1W , 7O1Y , 7O20 , 7O22 , 7QXY , 7QXZ , 7QY0 , 7QY1 , 7QY2 , 8B4V , 8B4W , 8B4X , 8OYH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16470	S8_pro-domain	33 → 107	Peptidase S8 pro-domain	Domain
PF00082	Peptidase_S8	144 → 427	Subtilase family	Domain
PF01483	P_proprotein	484 → 570	Proprotein convertase P-domain	Family

Tissue specificity

TISSUE SPECIFICITY: Seems to be expressed ubiquitously. {ECO:0000269|PubMed:1713771}.

Sequence

MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL

Sequence length

794

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1		Collagen degradation Elastic fibre formation Activation of Matrix Metalloproteinases Removal of aminoterminal propeptides from gamma-carboxylated proteins NGF processing Synthesis and processing of ENV and VPU Signaling by PDGF Pre-NOTCH Processing in Golgi TGF-beta receptor signaling activates SMADs Uptake and function of anthrax toxins Formation of the cornified envelope Assembly of active LPL and LIPC lipase complexes CD163 mediating an anti-inflammatory response Amyloid fiber formation

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hypertension	Hypertension (confirmatory factor analysis Factor 12), High blood pressure / hypertension, Hypertension	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Ischemic Stroke	Ischemic stroke	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Osteoarthritis Of Hip	Osteoarthritis of the hip or knee (with total joint replacement)	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (81)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32492203, 34510311, 35733175, 35960376
Alzheimer Disease	Associate	34108016
Arthritis Rheumatoid	Stimulate	29465367, 32840921
Asthma	Associate	33413387, 33455043
Atherosclerosis	Stimulate	29465367
Atrial Fibrillation	Associate	40304040
Bipolar Disorder	Associate	40562893
Brain Neoplasms	Associate	23097623
Breast Neoplasms	Associate	11335709, 29704427
Carcinogenesis	Associate	34671211, 36799665
Carcinoma Hepatocellular	Inhibit	35668069
Carcinoma Non Small Cell Lung	Associate	35960376
Carcinoma Squamous Cell	Associate	24436242, 32591666, 9166946
Cardiovascular Diseases	Associate	40596960
Cerebral Infarction	Associate	40304040
Chronic Disease	Associate	37239341
Cognition Disorders	Associate	34953024
Colonic Neoplasms	Associate	8760366
Coronary Artery Disease	Associate	32067586, 33910372, 37443715
Coronary Disease	Associate	37147786
Coronavirus Infections	Associate	32543348
COVID 19	Associate	21435673, 32543348, 32638018, 32691890, 32771700, 32825469, 32867305, 33243086, 33508651, 33662863, 33910372, 34330889, 34356057, 34410424, 34510311 View all (11 more)
Cystic Fibrosis	Associate	32668165, 35202587
Death	Associate	35355278
Dementia familial Danish	Associate	18282158
Diabetes Mellitus	Associate	35399937
Diabetes Mellitus Type 2	Associate	37147786
Disease	Associate	26342013
Drug Related Side Effects and Adverse Reactions	Associate	25997032
Dry Eye Syndromes	Stimulate	29465367
Dyslipidemias	Associate	37147786
Ectodermal Dysplasia 1 Anhidrotic	Associate	11416205
Essential Hypertension	Associate	20707915
Fabry Disease	Associate	22247037
Foot and Mouth Disease	Associate	27332822
Genetic Predisposition to Disease	Associate	32492203
Glioblastoma	Associate	11390472
Glioma	Associate	11390472, 15584904, 23097623, 28484053, 34953024
Head and Neck Neoplasms	Associate	12547702
Hypercholesterolemia	Associate	16912035, 35355278
Hypertension	Associate	20707915, 27760099, 32888289
Hypobetalipoproteinemia Familial 1	Associate	28633452
Hypobetalipoproteinemia Familial 2	Associate	28633452
Hypophosphatemic Rickets Autosomal Dominant	Associate	38493780
Hypotension	Associate	30706700
Hypoxia	Associate	18329003, 24436242
Infections	Stimulate	28566373, 36851526
Infections	Associate	35632769, 36144551
Inflammation	Associate	29465367, 32840921, 33413387
Ischemic Attack Transient	Associate	27760099
Kidney Neoplasms	Associate	29022645
Liver Failure Acute	Associate	17498766
Lung Neoplasms	Associate	40649939
Lupus Erythematosus Systemic	Stimulate	29465367
Lysosomal Storage Diseases	Associate	34807954
Melanoma	Associate	26283728, 29466742
Metaphyseal chondrodysplasia Schmid type	Associate	28440393
Mouth Neoplasms	Stimulate	32562913
Mucus Inspissation of Respiratory Tract	Associate	35202587
Myocardial Infarction	Associate	34579647
Myocardial Ischemia	Associate	37940228
Neoplasm Metastasis	Associate	26137475, 29704427, 32029900, 36799665
Neoplasms	Associate	12547702, 23409034, 24841138, 26137475, 32029900, 32512290, 32820145, 34510311, 34671211, 35960376, 36799665, 37624966, 9166946
Opioid Related Disorders	Associate	37252880
Ovarian Neoplasms	Associate	17641413, 32029900
Papillomavirus Infections	Associate	27122588
Plaque Atherosclerotic	Associate	34579647
Post Exercise Hypotension	Associate	30706700
Poult Enteritis Mortality Syndrome	Associate	34699015
Pressure Ulcer	Associate	25820152
Pulmonary Disease Chronic Obstructive	Associate	33978304, 34671211, 35046647
Respiratory System Abnormalities	Inhibit	29465367
Schizophrenia	Associate	27668389
Severe Acute Respiratory Syndrome	Associate	21435673
Sjogren's Syndrome	Stimulate	29465367
Sjogren's Syndrome	Associate	37239341
Small Cell Lung Carcinoma	Associate	9166946
Stroke	Associate	40596960
Thyroid Cancer Papillary	Associate	36799665
Uterine Cervical Neoplasms	Associate	32306508
Virus Diseases	Associate	33508651, 34699015, 34807954, 35012335, 35286852

FURIN (furin, paired basic amino acid cleaving enzyme)