Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
503835
Gene name Gene Name - the full gene name approved by the HGNC.
Double homeobox A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DUXA
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.43
Summary Summary of gene provided in NCBI Entrez Gene.
Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DUXA homeo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT617231 hsa-miR-4438 HITS-CLIP 23824327
MIRT617230 hsa-miR-7153-3p HITS-CLIP 23824327
MIRT617229 hsa-miR-4269 HITS-CLIP 23824327
MIRT617228 hsa-miR-6715b-5p HITS-CLIP 23824327
MIRT631014 hsa-miR-4740-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611168 32179 ENSG00000258873
Protein
UniProt ID A6NLW8
Protein name Double homeobox protein A
Protein function Transcription factor that acts as a repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 16 70 Homeodomain Domain
PF00046 Homeodomain 102 156 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonic stem cells. {ECO:0000269|PubMed:27412763}.
Sequence
MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQ
IWFQNRRARH
GFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAF
MKNPYPGIDSREELAKEIGVPESRVQIWFQNRRSRL
LLQRKREPVASLEQEEQGKIPEGL
QGAEDTQNGTNFTSDSHFSGARTW
Sequence length 204
Interactions View interactions
<