Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5027
Gene name	Purinergic receptor P2X 7
Gene symbol	P2RX7
Synonyms (NCBI Gene)	P2X7
Chromosome	12
Chromosome location	12q24.31
Summary	The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules.

315

Show/Hide all (315)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004356	hsa-miR-186-5p	qRT-PCRLuciferase reporter assay	18682393
MIRT004357	hsa-miR-150-5p	qRT-PCRLuciferase reporter assay	18682393
MIRT004357	hsa-miR-150-5p	Luciferase reporter assay	18682393
MIRT004356	hsa-miR-186-5p	Luciferase reporter assay	18682393
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT678528	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT678527	hsa-miR-520h	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT655568	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT655567	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT655566	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT655565	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT655563	hsa-miR-3921	HITS-CLIP	23824327
MIRT655564	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT655562	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT655561	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT655560	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT655559	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT655558	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT655557	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT655556	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT529935	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT529933	hsa-miR-1324	PAR-CLIP	22012620
MIRT529931	hsa-miR-6880-3p	PAR-CLIP	22012620
MIRT529932	hsa-miR-4312	PAR-CLIP	22012620
MIRT529930	hsa-miR-3167	PAR-CLIP	22012620
MIRT529929	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT443522	hsa-miR-4324	PAR-CLIP	22100165
MIRT443521	hsa-miR-544b	PAR-CLIP	22100165
MIRT443520	hsa-miR-4682	PAR-CLIP	22100165
MIRT443519	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT443518	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT443517	hsa-miR-1200	PAR-CLIP	22100165
MIRT443516	hsa-miR-218-1-3p	PAR-CLIP	22100165
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT678528	hsa-miR-520g-3p	HITS-CLIP	23824327
MIRT678527	hsa-miR-520h	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT004357	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678526	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678525	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT677140	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT677139	hsa-miR-764	HITS-CLIP	23824327
MIRT677138	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT677137	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT677136	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT677135	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT443518	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT677134	hsa-miR-640	HITS-CLIP	23824327
MIRT655568	hsa-miR-216b-5p	HITS-CLIP	23824327
MIRT655567	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT655566	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT655565	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT655563	hsa-miR-3921	HITS-CLIP	23824327
MIRT655564	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT655562	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT655561	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT655560	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT655559	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT655558	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT655557	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT655556	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT529935	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT529933	hsa-miR-1324	PAR-CLIP	22012620
MIRT529931	hsa-miR-6880-3p	PAR-CLIP	22012620
MIRT529932	hsa-miR-4312	PAR-CLIP	22012620
MIRT529930	hsa-miR-3167	PAR-CLIP	22012620
MIRT529929	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT443522	hsa-miR-4324	PAR-CLIP	22100165
MIRT443521	hsa-miR-544b	PAR-CLIP	22100165
MIRT443520	hsa-miR-4682	PAR-CLIP	22100165
MIRT443519	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT443518	hsa-miR-378a-5p	PAR-CLIP	22100165
MIRT443517	hsa-miR-1200	PAR-CLIP	22100165
MIRT443516	hsa-miR-218-1-3p	PAR-CLIP	22100165
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208955	hsa-miR-1234	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT1208957	hsa-miR-1266	CLIP-seq
MIRT1208958	hsa-miR-134	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT1208960	hsa-miR-1587	CLIP-seq
MIRT1208961	hsa-miR-214	CLIP-seq
MIRT1208962	hsa-miR-2682	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT1208964	hsa-miR-3118	CLIP-seq
MIRT1208965	hsa-miR-3166	CLIP-seq
MIRT1208966	hsa-miR-3619-5p	CLIP-seq
MIRT1208967	hsa-miR-3621	CLIP-seq
MIRT1208968	hsa-miR-3664-3p	CLIP-seq
MIRT1208969	hsa-miR-3934	CLIP-seq
MIRT1208970	hsa-miR-3937	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT1208972	hsa-miR-4257	CLIP-seq
MIRT1208973	hsa-miR-4436b-3p	CLIP-seq
MIRT1208974	hsa-miR-449c	CLIP-seq
MIRT1208975	hsa-miR-4518	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT1208979	hsa-miR-515-5p	CLIP-seq
MIRT1208980	hsa-miR-516a-3p	CLIP-seq
MIRT1208981	hsa-miR-518a-3p	CLIP-seq
MIRT1208982	hsa-miR-518b	CLIP-seq
MIRT1208983	hsa-miR-518c	CLIP-seq
MIRT1208984	hsa-miR-518d-3p	CLIP-seq
MIRT1208985	hsa-miR-518e	CLIP-seq
MIRT1208986	hsa-miR-518f	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT1208988	hsa-miR-635	CLIP-seq
MIRT1208989	hsa-miR-761	CLIP-seq
MIRT1208990	hsa-miR-940	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208955	hsa-miR-1234	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT1208981	hsa-miR-518a-3p	CLIP-seq
MIRT1208982	hsa-miR-518b	CLIP-seq
MIRT1208983	hsa-miR-518c	CLIP-seq
MIRT1208984	hsa-miR-518d-3p	CLIP-seq
MIRT1208985	hsa-miR-518e	CLIP-seq
MIRT1208986	hsa-miR-518f	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288344	hsa-miR-106a	CLIP-seq
MIRT2288345	hsa-miR-106b	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT2288346	hsa-miR-1245	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT1208959	hsa-miR-150	CLIP-seq
MIRT2288348	hsa-miR-17	CLIP-seq
MIRT2288349	hsa-miR-185	CLIP-seq
MIRT2288350	hsa-miR-1915	CLIP-seq
MIRT2288351	hsa-miR-20a	CLIP-seq
MIRT2288352	hsa-miR-20b	CLIP-seq
MIRT2288353	hsa-miR-2278	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2288356	hsa-miR-302a	CLIP-seq
MIRT2288357	hsa-miR-302b	CLIP-seq
MIRT2288358	hsa-miR-302c	CLIP-seq
MIRT2288359	hsa-miR-302d	CLIP-seq
MIRT2288360	hsa-miR-302e	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2288361	hsa-miR-3135b	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2288362	hsa-miR-3652	CLIP-seq
MIRT2288363	hsa-miR-3665	CLIP-seq
MIRT2288364	hsa-miR-372	CLIP-seq
MIRT2288365	hsa-miR-373	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208969	hsa-miR-3934	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2288366	hsa-miR-4306	CLIP-seq
MIRT2288367	hsa-miR-4430	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2288368	hsa-miR-4454	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288370	hsa-miR-4475	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT2288371	hsa-miR-4519	CLIP-seq
MIRT2288372	hsa-miR-451b	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2288374	hsa-miR-4644	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT2288375	hsa-miR-4707-3p	CLIP-seq
MIRT2288376	hsa-miR-4713-5p	CLIP-seq
MIRT2288377	hsa-miR-4726-3p	CLIP-seq
MIRT2288378	hsa-miR-4731-5p	CLIP-seq
MIRT1208978	hsa-miR-4763-5p	CLIP-seq
MIRT2288379	hsa-miR-5095	CLIP-seq
MIRT2288380	hsa-miR-512-3p	CLIP-seq
MIRT2288381	hsa-miR-519d	CLIP-seq
MIRT2288382	hsa-miR-520a-3p	CLIP-seq
MIRT2288383	hsa-miR-520b	CLIP-seq
MIRT2288384	hsa-miR-520c-3p	CLIP-seq
MIRT2288385	hsa-miR-520d-3p	CLIP-seq
MIRT2288386	hsa-miR-520e	CLIP-seq
MIRT2288387	hsa-miR-520g	CLIP-seq
MIRT2288388	hsa-miR-532-3p	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288390	hsa-miR-552	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288393	hsa-miR-657	CLIP-seq
MIRT2288394	hsa-miR-93	CLIP-seq
MIRT1208954	hsa-miR-122	CLIP-seq
MIRT1208956	hsa-miR-1254	CLIP-seq
MIRT2060032	hsa-miR-1285	CLIP-seq
MIRT1208963	hsa-miR-3116	CLIP-seq
MIRT2060033	hsa-miR-3187-5p	CLIP-seq
MIRT2060034	hsa-miR-378g	CLIP-seq
MIRT1208971	hsa-miR-4254	CLIP-seq
MIRT2060035	hsa-miR-4284	CLIP-seq
MIRT2060036	hsa-miR-4437	CLIP-seq
MIRT2060037	hsa-miR-4486	CLIP-seq
MIRT1208976	hsa-miR-4674	CLIP-seq
MIRT1208977	hsa-miR-4695-3p	CLIP-seq
MIRT1208987	hsa-miR-564	CLIP-seq
MIRT2060038	hsa-miR-612	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586487	hsa-miR-1231	CLIP-seq
MIRT2586488	hsa-miR-1261	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2586489	hsa-miR-1303	CLIP-seq
MIRT2586490	hsa-miR-149	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2586491	hsa-miR-3064-5p	CLIP-seq
MIRT2586492	hsa-miR-3149	CLIP-seq
MIRT2586493	hsa-miR-4422	CLIP-seq
MIRT2586494	hsa-miR-4436b-5p	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2586495	hsa-miR-4715-3p	CLIP-seq
MIRT2586496	hsa-miR-4735-5p	CLIP-seq
MIRT2586497	hsa-miR-4775	CLIP-seq
MIRT2586498	hsa-miR-4794	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586499	hsa-miR-590-3p	CLIP-seq
MIRT2586500	hsa-miR-642b	CLIP-seq
MIRT2586501	hsa-miR-654-3p	CLIP-seq
MIRT2586502	hsa-miR-668	CLIP-seq
MIRT2586503	hsa-miR-767-5p	CLIP-seq
MIRT2586487	hsa-miR-1231	CLIP-seq
MIRT2288347	hsa-miR-1297	CLIP-seq
MIRT2586489	hsa-miR-1303	CLIP-seq
MIRT2586490	hsa-miR-149	CLIP-seq
MIRT2288354	hsa-miR-26a	CLIP-seq
MIRT2288355	hsa-miR-26b	CLIP-seq
MIRT2586491	hsa-miR-3064-5p	CLIP-seq
MIRT2586492	hsa-miR-3149	CLIP-seq
MIRT2288369	hsa-miR-4465	CLIP-seq
MIRT2288373	hsa-miR-4532	CLIP-seq
MIRT2586495	hsa-miR-4715-3p	CLIP-seq
MIRT2586496	hsa-miR-4735-5p	CLIP-seq
MIRT2586497	hsa-miR-4775	CLIP-seq
MIRT2586498	hsa-miR-4794	CLIP-seq
MIRT2288389	hsa-miR-550a	CLIP-seq
MIRT2288391	hsa-miR-578	CLIP-seq
MIRT2288392	hsa-miR-581	CLIP-seq
MIRT2586499	hsa-miR-590-3p	CLIP-seq
MIRT2586501	hsa-miR-654-3p	CLIP-seq
MIRT2586503	hsa-miR-767-5p	CLIP-seq

156

Show/Hide all (156)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0001530	Function	Lipopolysaccharide binding	ISS
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	9038151
GO:0001614	Function	Purinergic nucleotide receptor activity	IEA
GO:0001845	Process	Phagolysosome assembly	IEA
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS	17785580
GO:0002931	Process	Response to ischemia	NAS	12849743
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IBA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IDA	9038151, 17483156
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IEA
GO:0005102	Function	Signaling receptor binding	ISS	17785580
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005267	Function	Potassium channel activity	IDA	17483156
GO:0005272	Function	Sodium channel activity	IDA	17483156
GO:0005515	Function	Protein binding	IPI	12107182, 25416956, 25651887, 32296183
GO:0005524	Function	ATP binding	IC	9038151
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	9038151
GO:0005886	Component	Plasma membrane	IDA	12107182
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS	17785580
GO:0005886	Component	Plasma membrane	TAS	17299767
GO:0005911	Component	Cell-cell junction	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IEA
GO:0006649	Process	Phospholipid transfer to membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006884	Process	Cell volume homeostasis	IEA
GO:0006900	Process	Vesicle budding from membrane	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007009	Process	Plasma membrane organization	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0009306	Process	Protein secretion	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IDA	9038151
GO:0010628	Process	Positive regulation of gene expression	IMP	22898868
GO:0012501	Process	Programmed cell death	IEA
GO:0014047	Process	Glutamate secretion	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014051	Process	Gamma-aminobutyric acid secretion	IEA
GO:0014054	Process	Positive regulation of gamma-aminobutyric acid secretion	IEA
GO:0015267	Function	Channel activity	IEA
GO:0015748	Process	Organophosphate ester transport	IEA
GO:0016020	Component	Membrane	IDA	17785580
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IEA
GO:0016485	Process	Protein processing	IEA
GO:0017121	Process	Plasma membrane phospholipid scrambling	IDA	25651887
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019722	Process	Calcium-mediated signaling	TAS	12151016
GO:0030163	Process	Protein catabolic process	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0032059	Component	Bleb	ISS
GO:0032060	Process	Bleb assembly	IDA	12107182
GO:0032060	Process	Bleb assembly	IEA
GO:0032060	Process	Bleb assembly	IEA
GO:0032060	Process	Bleb assembly	ISS
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032310	Process	Prostaglandin secretion	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	17036048, 18089587
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032963	Process	Collagen metabolic process	IEA
GO:0033198	Process	Response to ATP	IDA	9038151
GO:0033198	Process	Response to ATP	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034405	Process	Response to fluid shear stress	IEA
GO:0034767	Process	Positive regulation of monoatomic ion transmembrane transport	IMP	25651887
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IMP	25651887
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	TAS	12151016
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043132	Process	NAD transport	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045202	Component	Synapse	IEA
GO:0045332	Process	Phospholipid translocation	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045779	Process	Negative regulation of bone resorption	IEA
GO:0045779	Process	Negative regulation of bone resorption	ISS
GO:0045794	Process	Negative regulation of cell volume	IEA
GO:0045794	Process	Negative regulation of cell volume	IMP	25651887
GO:0045821	Process	Positive regulation of glycolytic process	IMP	22898868
GO:0046513	Process	Ceramide biosynthetic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046931	Process	Pore complex assembly	IDA	9038151
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IEA
GO:0046931	Process	Pore complex assembly	IMP	25651887
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IEA
GO:0051495	Process	Positive regulation of cytoskeleton organization	ISS
GO:0051592	Process	Response to calcium ion	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051882	Process	Mitochondrial depolarization	IEA
GO:0051899	Process	Membrane depolarization	IDA	9038151
GO:0051899	Process	Membrane depolarization	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070207	Process	Protein homotrimerization	IDA	31587896
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070230	Process	Positive regulation of lymphocyte apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0071318	Process	Cellular response to ATP	TAS	12151016
GO:0071359	Process	Cellular response to dsRNA	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	ISS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	ISS
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	ISS
GO:1904172	Process	Positive regulation of bleb assembly	IMP	25651887

MIM	HGNC	e!Ensembl
602566	8537	ENSG00000089041

Q99572

Protein name

P2X purinoceptor 7 (P2X7) (ATP receptor) (P2Z receptor) (Purinergic receptor)

Protein function

ATP-gated nonselective transmembrane cation channel that requires high millimolar concentrations of ATP for activation (PubMed:17483156, PubMed:25281740, PubMed:9038151). Upon ATP binding, it rapidly opens to allow the influx of small cations Na

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	11 → 395		Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in brain and immune tissues. {ECO:0000269|PubMed:15896293}.; TISSUE SPECIFICITY: [Isoform B]: Predominant form in many tissues. {ECO:0000269|PubMed:15896293}.

Sequence

MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Sequence length

595

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction NOD-like receptor signaling pathway		Elevation of cytosolic Ca2+ levels Platelet homeostasis The NLRP3 inflammasome Purinergic signaling in leishmaniasis infection

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs35933842	RCV005898565
Adrenocortical carcinoma, hereditary	Likely benign	rs35933842	RCV005898568
Clear cell carcinoma of kidney	Likely benign	rs35933842	RCV005898569
Hepatocellular carcinoma	Likely benign	rs35933842	RCV005898566
Malignant tumor of esophagus	Likely benign	rs35933842	RCV005898567
Melanoma	Likely benign	rs35933842	RCV005898570
P2RX7-related disorder	Likely benign; Benign	rs199972027, rs201778812	RCV003896864 RCV003948407

Show/Hide Text Mining Associations (134)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abidi X linked mental retardation syndrome	Associate	28737528
Adenocarcinoma of Lung	Associate	33042257
Aggressive Periodontitis	Associate	31292966, 31319038
Alzheimer Disease	Associate	25456845
Anemia	Associate	35021220
Anemia Aplastic	Associate	17488689
Anxiety	Associate	37173368
Anxiety Disorders	Associate	37173368
Apraxias	Associate	38255938
Arthritis Gouty	Associate	28797095
Arthritis Psoriatic	Stimulate	23479230
Arthritis Rheumatoid	Associate	19226284, 32868411
Atherosclerosis	Associate	22662160, 32436587
Autoimmune Diseases	Associate	23479230, 36470550
Bacteremia	Associate	17488689
Behcet Syndrome	Associate	24105615
Bipolar Disorder	Associate	22952630, 28751646
Birdshot Chorioretinopathy	Associate	20535134
Bone Diseases	Associate	19226284, 22234152, 22274585, 35266012
Brain Diseases	Associate	29329985
Breast Cancer Lymphedema	Associate	24934217
Carcinoma Hepatocellular	Associate	25722111, 27272229
Carcinoma Non Small Cell Lung	Associate	25178922, 36854856
Carcinoma Pancreatic Ductal	Associate	26607222
Carcinoma Renal Cell	Associate	26179886
Carcinoma Squamous Cell	Associate	27779103
Cerebral Infarction	Associate	22662160
Cholangiocarcinoma	Associate	30889491
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	25798846
Colorectal Neoplasms	Associate	34862210, 38195677
Coronary Stenosis	Associate	32436587
COVID 19	Stimulate	35091759
COVID 19	Associate	35648256
Crohn Disease	Associate	17257221
Cryopyrin Associated Periodic Syndromes	Associate	25730877
Cytokine Release Syndrome	Stimulate	11341329
Death	Associate	38195677
Depressive Disorder	Stimulate	24143878
Depressive Disorder	Associate	32699209, 34111150
Diabetes Complications	Associate	39869622
Diabetes Mellitus Type 2	Associate	39869622
Diabetic Neuropathies	Associate	24934217
Diabetic Retinopathy	Associate	33291318
Dissection Thoracic Aorta	Associate	30066903
Drug Related Side Effects and Adverse Reactions	Associate	25103241, 26467741, 28176024, 32486485, 33071281
Drug Related Side Effects and Adverse Reactions	Stimulate	26607222
Epilepsy	Associate	26714441, 28389651
Fahr's disease	Associate	20535134
Fatigue Syndrome Chronic	Stimulate	24054763
Fatty Liver Alcoholic	Associate	30447168
Focal Cortical Dysplasia	Associate	34301297
Focal cortical dysplasia of Taylor	Associate	34301297
Fractures Bone	Associate	22776862
Glioblastoma	Associate	31905754, 35075119
Glioma	Associate	22644907
Gout	Associate	27550484, 28797095, 30447168, 37020014
Head and Neck Neoplasms	Associate	28430665
Helicobacter Infections	Associate	27259265
Heredodegenerative Disorders Nervous System	Associate	23691096
HIV Infections	Associate	27082982
Huntington Disease	Stimulate	25798846
Hyperuricemia	Associate	28797095
Infections	Associate	17488689
Inflammation	Associate	20185692, 23691096, 23819992, 23906036, 25456845, 25730877, 26179886, 27145808, 28343378, 28389651, 28503820, 29375053, 30210654, 30622236, 31292966 View all (5 more)
Inflammation	Stimulate	23479230, 26337470, 26495439, 33291318
Inflammation	Inhibit	36107259
Ischemia	Associate	35422072
Kidney Diseases	Associate	39869622
Leukemia	Associate	15972634
Leukemia Lymphocytic Chronic B Cell	Associate	11003599, 11781259, 12586825, 15972634, 28570130
Leukemia Myeloid	Associate	22661222
Leukemia Myeloid Acute	Stimulate	33071281
Lung Neoplasms	Associate	26491047, 30762755
Lung Neoplasms	Inhibit	32638267
Lupus Erythematosus Systemic	Associate	31376246, 32868411
Lymphatic Diseases	Associate	38401466
Lymphatic Metastasis	Stimulate	32070268
Lymphoma B Cell Marginal Zone	Stimulate	28503820
Lymphoma Large B Cell Diffuse	Associate	37222921
Lymphoma Non Hodgkin	Associate	28503820
Melanoma	Associate	37379213
Mitochondrial Diseases	Associate	32486485
Mitral Valve Prolapse	Associate	37180137
Mood Disorders	Associate	38255938
Multiple Myeloma	Associate	33105696
Multiple Sclerosis	Associate	28326637, 35648256, 36470550, 36499708
Myocardial Infarction	Stimulate	32436587
Myocardial Ischemia	Associate	22662160
Necrosis	Associate	26607222
Neoplasm Metastasis	Associate	26687764, 31042071
Neoplasm Metastasis	Stimulate	32070268, 36803784
Neoplasms	Associate	17035398, 18431793, 25178922, 25226385, 26179886, 30447168, 33042257, 34940128, 36854856, 39693800
Neoplasms	Stimulate	32070268
Neuralgia	Associate	24934217, 27145808
Neuralgia Postherpetic	Inhibit	32517404
Neuralgia Postherpetic	Associate	32517404
Neuroblastoma	Associate	26687764
Neurodegenerative Diseases	Associate	17085972, 26467741, 32486485, 34111150
Neuroinflammatory Diseases	Associate	31562223, 34111150, 36499708, 37173368, 38255938
Osteoarthritis	Associate	24934217, 28343378
Osteomyelitis	Associate	38401466
Osteoporosis	Associate	19226284, 22234152, 22776862, 28497417
Osteosarcoma	Associate	25226385, 36803784
Ovarian Neoplasms	Associate	39693800
Pain	Associate	18431793, 24934217, 28389651, 29470314, 30210654, 30762755
Pain Postoperative	Associate	29470314, 30762755
Parkinson Disease	Associate	32486485, 39957192
Pericarditis	Associate	31376246
Peripheral Arterial Disease	Associate	39869622
Peripheral Nervous System Diseases	Associate	39869622
Prodromal Symptoms	Associate	34862210
Prostatic Neoplasms	Associate	26337470
Psoriasis	Associate	23479230, 38401466
Pulmonary Fibrosis	Associate	30447168
Q Fever	Associate	30616015
Rectal Neoplasms	Associate	37369459
Retinal Diseases	Associate	20535134
Root Resorption	Associate	25865535, 33466672, 37526277
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	28737528
Seizures Febrile	Associate	24703484
Signs and Symptoms Digestive	Associate	38401466
Sjogren's Syndrome	Associate	23819992, 23906036, 28503820
Sleep Deprivation	Associate	22952630
Sleep Deprivation	Stimulate	22952630
Spondylocostal dysostosis autosomal recessive	Associate	22234152, 22274585
Stomach Neoplasms	Associate	31042071, 32070268
Thyroid Neoplasms	Associate	25178922
Toxoplasmosis	Associate	20535134
Tuberculosis Lymph Node	Associate	36672948
Tuberculosis Meningeal	Associate	20164546
Tuberculosis Pulmonary	Associate	20164546, 27672203
Uterine Cervical Neoplasms	Associate	27779103
Uterine Neoplasms	Associate	17035398
Wounds and Injuries	Associate	37173368, 38255938

P2RX7 (purinergic receptor P2X 7)