Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5025
Gene name Gene Name - the full gene name approved by the HGNC.	Purinergic receptor P2X 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	P2RX4
Synonyms (NCBI Gene) Gene synonyms aliases	P2X4, P2X4R
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relat

Show/Hide all(122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017849	hsa-miR-335-5p	Microarray	18185580
MIRT1208885	hsa-miR-1184	CLIP-seq
MIRT1208886	hsa-miR-1205	CLIP-seq
MIRT1208887	hsa-miR-1231	CLIP-seq
MIRT1208888	hsa-miR-1909	CLIP-seq
MIRT1208889	hsa-miR-219-1-3p	CLIP-seq
MIRT1208890	hsa-miR-221	CLIP-seq
MIRT1208891	hsa-miR-222	CLIP-seq
MIRT1208892	hsa-miR-2861	CLIP-seq
MIRT1208893	hsa-miR-3151	CLIP-seq
MIRT1208894	hsa-miR-3169	CLIP-seq
MIRT1208895	hsa-miR-3653	CLIP-seq
MIRT1208896	hsa-miR-3658	CLIP-seq
MIRT1208897	hsa-miR-3663-5p	CLIP-seq
MIRT1208898	hsa-miR-3934	CLIP-seq
MIRT1208899	hsa-miR-4257	CLIP-seq
MIRT1208900	hsa-miR-4271	CLIP-seq
MIRT1208901	hsa-miR-4447	CLIP-seq
MIRT1208902	hsa-miR-4472	CLIP-seq
MIRT1208903	hsa-miR-4515	CLIP-seq
MIRT1208904	hsa-miR-4650-5p	CLIP-seq
MIRT1208905	hsa-miR-4690-3p	CLIP-seq
MIRT1208906	hsa-miR-4725-3p	CLIP-seq
MIRT1208907	hsa-miR-4726-3p	CLIP-seq
MIRT1208908	hsa-miR-4773	CLIP-seq
MIRT1208909	hsa-miR-4787-5p	CLIP-seq
MIRT1208910	hsa-miR-4790-3p	CLIP-seq
MIRT1208911	hsa-miR-491-5p	CLIP-seq
MIRT1208912	hsa-miR-548v	CLIP-seq
MIRT1208913	hsa-miR-596	CLIP-seq
MIRT1208914	hsa-miR-604	CLIP-seq
MIRT1208915	hsa-miR-625	CLIP-seq
MIRT1208916	hsa-miR-647	CLIP-seq
MIRT1208917	hsa-miR-654-3p	CLIP-seq
MIRT1208918	hsa-miR-671-5p	CLIP-seq
MIRT1208889	hsa-miR-219-1-3p	CLIP-seq
MIRT2288334	hsa-miR-3150b-3p	CLIP-seq
MIRT2288335	hsa-miR-3921	CLIP-seq
MIRT2288336	hsa-miR-4649-3p	CLIP-seq
MIRT2288337	hsa-miR-4653-5p	CLIP-seq
MIRT2288338	hsa-miR-4689	CLIP-seq
MIRT2288339	hsa-miR-4784	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2288341	hsa-miR-539	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2288343	hsa-miR-942	CLIP-seq
MIRT2586460	hsa-miR-106a	CLIP-seq
MIRT2586461	hsa-miR-106b	CLIP-seq
MIRT2586462	hsa-miR-1273e	CLIP-seq
MIRT2586463	hsa-miR-142-5p	CLIP-seq
MIRT2586464	hsa-miR-17	CLIP-seq
MIRT2586465	hsa-miR-20a	CLIP-seq
MIRT2586466	hsa-miR-20b	CLIP-seq
MIRT2586467	hsa-miR-302a	CLIP-seq
MIRT2586468	hsa-miR-302b	CLIP-seq
MIRT2586469	hsa-miR-302c	CLIP-seq
MIRT2586470	hsa-miR-302d	CLIP-seq
MIRT2586471	hsa-miR-302e	CLIP-seq
MIRT2586472	hsa-miR-331-3p	CLIP-seq
MIRT2586473	hsa-miR-3609	CLIP-seq
MIRT2586474	hsa-miR-372	CLIP-seq
MIRT2586475	hsa-miR-373	CLIP-seq
MIRT2586476	hsa-miR-3937	CLIP-seq
MIRT1208907	hsa-miR-4726-3p	CLIP-seq
MIRT2586477	hsa-miR-4755-3p	CLIP-seq
MIRT2586478	hsa-miR-4796-3p	CLIP-seq
MIRT2586479	hsa-miR-519d	CLIP-seq
MIRT2586480	hsa-miR-520a-3p	CLIP-seq
MIRT2586481	hsa-miR-520b	CLIP-seq
MIRT2586482	hsa-miR-520c-3p	CLIP-seq
MIRT2586483	hsa-miR-520d-3p	CLIP-seq
MIRT2586484	hsa-miR-520e	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2586485	hsa-miR-548ah	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2586486	hsa-miR-93	CLIP-seq
MIRT2586460	hsa-miR-106a	CLIP-seq
MIRT2586461	hsa-miR-106b	CLIP-seq
MIRT2586462	hsa-miR-1273e	CLIP-seq
MIRT2686965	hsa-miR-1343	CLIP-seq
MIRT2586463	hsa-miR-142-5p	CLIP-seq
MIRT2586464	hsa-miR-17	CLIP-seq
MIRT2686966	hsa-miR-185	CLIP-seq
MIRT2586465	hsa-miR-20a	CLIP-seq
MIRT2586466	hsa-miR-20b	CLIP-seq
MIRT1208892	hsa-miR-2861	CLIP-seq
MIRT2586467	hsa-miR-302a	CLIP-seq
MIRT2586468	hsa-miR-302b	CLIP-seq
MIRT2586469	hsa-miR-302c	CLIP-seq
MIRT2586470	hsa-miR-302d	CLIP-seq
MIRT2586471	hsa-miR-302e	CLIP-seq
MIRT2686967	hsa-miR-3135b	CLIP-seq
MIRT1208894	hsa-miR-3169	CLIP-seq
MIRT2586472	hsa-miR-331-3p	CLIP-seq
MIRT2586473	hsa-miR-3609	CLIP-seq
MIRT2686968	hsa-miR-3690	CLIP-seq
MIRT2586474	hsa-miR-372	CLIP-seq
MIRT2586475	hsa-miR-373	CLIP-seq
MIRT2586476	hsa-miR-3937	CLIP-seq
MIRT2686969	hsa-miR-4254	CLIP-seq
MIRT1208899	hsa-miR-4257	CLIP-seq
MIRT2686970	hsa-miR-4306	CLIP-seq
MIRT2686971	hsa-miR-4459	CLIP-seq
MIRT2686972	hsa-miR-4487	CLIP-seq
MIRT2686973	hsa-miR-4494	CLIP-seq
MIRT1208903	hsa-miR-4515	CLIP-seq
MIRT2686974	hsa-miR-4644	CLIP-seq
MIRT2686975	hsa-miR-4695-5p	CLIP-seq
MIRT2586477	hsa-miR-4755-3p	CLIP-seq
MIRT1208908	hsa-miR-4773	CLIP-seq
MIRT2586478	hsa-miR-4796-3p	CLIP-seq
MIRT2586479	hsa-miR-519d	CLIP-seq
MIRT2586480	hsa-miR-520a-3p	CLIP-seq
MIRT2586481	hsa-miR-520b	CLIP-seq
MIRT2586482	hsa-miR-520c-3p	CLIP-seq
MIRT2586483	hsa-miR-520d-3p	CLIP-seq
MIRT2586484	hsa-miR-520e	CLIP-seq
MIRT2288340	hsa-miR-520f	CLIP-seq
MIRT2586485	hsa-miR-548ah	CLIP-seq
MIRT2686976	hsa-miR-628-5p	CLIP-seq
MIRT2288342	hsa-miR-636	CLIP-seq
MIRT2586486	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP1	Repression	11299224

Show/Hide all(71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	9016352
GO:0001614	Function	Purinergic nucleotide receptor activity	IMP	11606481
GO:0001894	Process	Tissue homeostasis	NAS	17264311
GO:0002028	Process	Regulation of sodium ion transport	ISS	17785580
GO:0002931	Process	Response to ischemia	ISS
GO:0004931	Function	Extracellularly ATP-gated cation channel activity	IBA	21873635
GO:0004931	Function	Extracellularly ATP-gated cation channel activity	IDA	9016352, 10515189
GO:0005102	Function	Signaling receptor binding	ISS	17785580
GO:0005507	Function	Copper ion binding	ISS	12819199
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005524	Function	ATP binding	IC	11606481
GO:0005639	Component	Integral component of nuclear inner membrane	IBA	21873635
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005886	Component	Plasma membrane	IDA	23303206
GO:0005886	Component	Plasma membrane	ISS	17785580
GO:0005886	Component	Plasma membrane	TAS	17299767
GO:0005887	Component	Integral component of plasma membrane	IC	11606481
GO:0005887	Component	Integral component of plasma membrane	IMP	10515189
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0007165	Process	Signal transduction	IDA	9016352
GO:0007596	Process	Blood coagulation	TAS
GO:0008217	Process	Regulation of blood pressure	IMP	11606481, 15130891
GO:0008270	Function	Zinc ion binding	ISS	12819199
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IDA	10969036
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IMP	10899068
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IMP	15130891
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	17785580
GO:0019228	Process	Neuronal action potential	IEA
GO:0019233	Process	Sensory perception of pain	ISS	14978347
GO:0019722	Process	Calcium-mediated signaling	TAS	17299767
GO:0030054	Component	Cell junction	IDA	12088286
GO:0032308	Process	Positive regulation of prostaglandin secretion	NAS	10899068
GO:0033198	Process	Response to ATP	IDA	9016352
GO:0034220	Process	Ion transmembrane transport	IDA	10515189
GO:0034405	Process	Response to fluid shear stress	IDA	10969036
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IMP	11606481
GO:0042118	Process	Endothelial cell activation	TAS	12088286
GO:0042802	Function	Identical protein binding	IPI	9016352
GO:0043025	Component	Neuronal cell body	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	21106936
GO:0044297	Component	Cell body	ISS
GO:0045296	Function	Cadherin binding	IPI	12088286
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	NAS	10899068
GO:0048266	Process	Behavioral response to pain	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12088286
GO:0048678	Process	Response to axon injury	ISS
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	10969036
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	10899068
GO:0050920	Process	Regulation of chemotaxis	ISS
GO:0050975	Process	Sensory perception of touch	ISS
GO:0051897	Process	Positive regulation of protein kinase B signaling	ISS
GO:0051899	Process	Membrane depolarization	IDA	9016352
GO:0051928	Process	Positive regulation of calcium ion transport	NAS	15130891
GO:0055117	Process	Regulation of cardiac muscle contraction	IMP	11606481, 15130891
GO:0055119	Process	Relaxation of cardiac muscle	IMP	11606481, 15130891
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070588	Process	Calcium ion transmembrane transport	IDA	9016352
GO:0071294	Process	Cellular response to zinc ion	ISS
GO:0071318	Process	Cellular response to ATP	IDA	10515189
GO:0097190	Process	Apoptotic signaling pathway	IDA	17264311
GO:0099604	Function	Ligand-gated calcium channel activity	IDA	9016352
GO:0099604	Function	Ligand-gated calcium channel activity	ISS
GO:1900027	Process	Regulation of ruffle assembly	ISS
GO:1904124	Process	Microglial cell migration	TAS	28912710
GO:1904141	Process	Positive regulation of microglial cell migration	ISS
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	21106936

MIM	HGNC	e!Ensembl
600846	8535	ENSG00000135124

Protein

UniProt ID

Q99571

Protein name

P2X purinoceptor 4 (P2X4) (ATP receptor) (Purinergic receptor)

Protein function

ATP-gated nonselective transmembrane cation channel permeable to potassium, sodium and calcium (PubMed:9016352). CTP, but not GTP or UTP, functions as a weak affinity agonist for P2RX4 (By similarity). Activated by extracellularly released ATP,

PDB

9BQH , 9BQI , 9C48

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	13 → 379		Family

Sequence

MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIP
DATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAG
HSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY
RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYC
MKKRLYYREKKYKYVEDYEQGLASELDQ

Sequence length

388

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Elevation of cytosolic Ca2+ levels Platelet homeostasis Purinergic signaling in leishmaniasis infection

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Epilepsy	Epilepsy, Epilepsy, Temporal Lobe, Uncinate Epilepsy, Epilepsy, Cryptogenic, Epilepsy, Benign Psychomotor, Childhood, Epilepsy, Lateral Temporal, Awakening Epilepsy	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	12941474, 19084381

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Schizophrenia	Schizophrenia	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
AIDS Associated Nephropathy	Associate	37166584
Breast Neoplasms	Associate	38259456
COVID 19	Stimulate	35091759
Death	Associate	31285280
Hepatitis Alcoholic	Associate	35806450
Hepatitis C	Associate	35806450
Inflammation	Associate	17351655, 35806450
Lung Neoplasms	Associate	26491047
Multiple Sclerosis	Associate	28326637
Non alcoholic Fatty Liver Disease	Associate	35806450
Osteoporosis	Associate	23138503
Pain	Associate	33530940
Uveal melanoma	Associate	37563735

P2RX4 (purinergic receptor P2X 4)