Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5021
Gene name Gene Name - the full gene name approved by the HGNC.	Oxytocin receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OXTR
Synonyms (NCBI Gene) Gene synonyms aliases	OT-R, OTR
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin rece

Show/Hide all(139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023713	hsa-miR-1-3p	Microarray	18668037
MIRT1208809	hsa-miR-1270	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208811	hsa-miR-1305	CLIP-seq
MIRT1208812	hsa-miR-1915	CLIP-seq
MIRT1208813	hsa-miR-210	CLIP-seq
MIRT1208814	hsa-miR-25	CLIP-seq
MIRT1208815	hsa-miR-29a	CLIP-seq
MIRT1208816	hsa-miR-29b	CLIP-seq
MIRT1208817	hsa-miR-29c	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208819	hsa-miR-3168	CLIP-seq
MIRT1208820	hsa-miR-32	CLIP-seq
MIRT1208821	hsa-miR-3200-3p	CLIP-seq
MIRT1208822	hsa-miR-338-3p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208824	hsa-miR-3607-5p	CLIP-seq
MIRT1208825	hsa-miR-363	CLIP-seq
MIRT1208826	hsa-miR-367	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208828	hsa-miR-3922-5p	CLIP-seq
MIRT1208829	hsa-miR-409-3p	CLIP-seq
MIRT1208830	hsa-miR-4281	CLIP-seq
MIRT1208831	hsa-miR-4310	CLIP-seq
MIRT1208832	hsa-miR-4325	CLIP-seq
MIRT1208833	hsa-miR-4434	CLIP-seq
MIRT1208834	hsa-miR-4436b-3p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208836	hsa-miR-448	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208838	hsa-miR-4516	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208840	hsa-miR-451b	CLIP-seq
MIRT1208841	hsa-miR-4531	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208843	hsa-miR-4635	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT1208845	hsa-miR-4659a-5p	CLIP-seq
MIRT1208846	hsa-miR-4659b-5p	CLIP-seq
MIRT1208847	hsa-miR-4685-5p	CLIP-seq
MIRT1208848	hsa-miR-4754	CLIP-seq
MIRT1208849	hsa-miR-4766-3p	CLIP-seq
MIRT1208850	hsa-miR-4776-3p	CLIP-seq
MIRT1208851	hsa-miR-4778-3p	CLIP-seq
MIRT1208852	hsa-miR-4796-5p	CLIP-seq
MIRT1208853	hsa-miR-496	CLIP-seq
MIRT1208854	hsa-miR-498	CLIP-seq
MIRT1208855	hsa-miR-539	CLIP-seq
MIRT1208856	hsa-miR-576-5p	CLIP-seq
MIRT1208857	hsa-miR-587	CLIP-seq
MIRT1208858	hsa-miR-620	CLIP-seq
MIRT1208859	hsa-miR-9	CLIP-seq
MIRT1208860	hsa-miR-92a	CLIP-seq
MIRT1208861	hsa-miR-92b	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2060009	hsa-miR-1292	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT2060010	hsa-miR-1303	CLIP-seq
MIRT2060011	hsa-miR-216a	CLIP-seq
MIRT2060012	hsa-miR-3124-3p	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT2060013	hsa-miR-3613-3p	CLIP-seq
MIRT2060014	hsa-miR-3655	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT2060015	hsa-miR-4289	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT2060016	hsa-miR-4471	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2060017	hsa-miR-4729	CLIP-seq
MIRT2060018	hsa-miR-511	CLIP-seq
MIRT2060019	hsa-miR-548c-3p	CLIP-seq
MIRT2060020	hsa-miR-578	CLIP-seq
MIRT2060021	hsa-miR-579	CLIP-seq
MIRT1208857	hsa-miR-587	CLIP-seq
MIRT2288315	hsa-miR-1225-5p	CLIP-seq
MIRT1208809	hsa-miR-1270	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT2060010	hsa-miR-1303	CLIP-seq
MIRT2288316	hsa-miR-153	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT2288317	hsa-miR-33a	CLIP-seq
MIRT2288318	hsa-miR-33b	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT2288319	hsa-miR-3692	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT2288320	hsa-miR-3940-5p	CLIP-seq
MIRT2288321	hsa-miR-4263	CLIP-seq
MIRT2288322	hsa-miR-4272	CLIP-seq
MIRT2288323	hsa-miR-4307	CLIP-seq
MIRT1208832	hsa-miR-4325	CLIP-seq
MIRT1208833	hsa-miR-4434	CLIP-seq
MIRT2288324	hsa-miR-4436b-5p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208836	hsa-miR-448	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT2288325	hsa-miR-4507	CLIP-seq
MIRT1208838	hsa-miR-4516	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208840	hsa-miR-451b	CLIP-seq
MIRT1208841	hsa-miR-4531	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2288326	hsa-miR-4753-3p	CLIP-seq
MIRT1208849	hsa-miR-4766-3p	CLIP-seq
MIRT2288327	hsa-miR-4768-5p	CLIP-seq
MIRT1208851	hsa-miR-4778-3p	CLIP-seq
MIRT2288328	hsa-miR-4780	CLIP-seq
MIRT1208852	hsa-miR-4796-5p	CLIP-seq
MIRT1208855	hsa-miR-539	CLIP-seq
MIRT2288329	hsa-miR-555	CLIP-seq
MIRT1208856	hsa-miR-576-5p	CLIP-seq
MIRT2060021	hsa-miR-579	CLIP-seq
MIRT1208858	hsa-miR-620	CLIP-seq
MIRT2288330	hsa-miR-623	CLIP-seq
MIRT2288331	hsa-miR-635	CLIP-seq
MIRT1208859	hsa-miR-9	CLIP-seq
MIRT1208810	hsa-miR-1293	CLIP-seq
MIRT1208818	hsa-miR-3127-5p	CLIP-seq
MIRT1208823	hsa-miR-3529	CLIP-seq
MIRT1208827	hsa-miR-379	CLIP-seq
MIRT1208829	hsa-miR-409-3p	CLIP-seq
MIRT1208835	hsa-miR-4451	CLIP-seq
MIRT1208837	hsa-miR-4483	CLIP-seq
MIRT1208839	hsa-miR-4519	CLIP-seq
MIRT1208842	hsa-miR-4536	CLIP-seq
MIRT1208844	hsa-miR-4650-3p	CLIP-seq
MIRT2455773	hsa-miR-3942-3p	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
CEBPB	Activation	21734268
FOS	Unknown	10218980
GABPA	Unknown	10218980
GABPB1	Unknown	10218980
JUN	Unknown	10218980
MAFF	Unknown	10527846
RELA	Activation	21734268
SP1	Unknown	22030357

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001967	Process	Suckling behavior	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004990	Function	Oxytocin receptor activity	IBA	21873635
GO:0005000	Function	Vasopressin receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005902	Component	Microvillus	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0006936	Process	Muscle contraction	TAS	1313946
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	1313946
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007507	Process	Heart development	IEA
GO:0007565	Process	Female pregnancy	IBA	21873635
GO:0007595	Process	Lactation	TAS	1313946
GO:0007613	Process	Memory	IEA
GO:0010701	Process	Positive regulation of norepinephrine secretion	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030431	Process	Sleep	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0034059	Process	Response to anoxia	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035176	Process	Social behavior	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042493	Process	Response to drug	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042713	Process	Sperm ejaculation	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0048565	Process	Digestive tract development	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0060137	Process	Maternal process involved in parturition	IBA	21873635
GO:0060406	Process	Positive regulation of penile erection	IEA
GO:0060455	Process	Negative regulation of gastric acid secretion	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24002032

MIM	HGNC	e!Ensembl
167055	8529	ENSG00000180914

Protein

UniProt ID

P30559

Protein name

Oxytocin receptor (OT-R)

Protein function

Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

PDB

6TPK , 7QVM , 7RYC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	56 → 329	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA

Sequence length

389

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Oxytocin signaling pathway		Vasopressin-like receptors G alpha (q) signalling events

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728 View all (51 more)	20832055
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	15288368, 17893705, 21082655, 18207134, 17383819, 15992526
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	17043644
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20196918

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder		19515497, 25262417, 24703166, 20708845, 22510359, 21208749	ClinVar

Show/Hide Text Mining Associations (107)

Disease Name	Relationship Type	References
Associations from Text Mining
Abuse dwarfism syndrome	Associate	26822448
Adenocarcinoma	Associate	26406593
Adenomyosis	Associate	20413116, 22999795, 25627343, 33305666
Alcohol Related Disorders	Associate	25003328, 26228411
Anhedonia	Associate	31220321, 32580785
Anorexia	Associate	26106053
Anorexia Nervosa	Associate	24523928, 26106053
Antisocial Personality Disorder	Associate	25003328, 27036876, 29927293, 32580785, 32693857
Anxiety	Associate	20708845, 24523928, 25262417, 27108164, 32957930, 33168330, 35063684, 35462200
Anxiety Disorders	Associate	20708845, 28017919, 28353027
Anxiety Separation	Associate	27872764
Apraxias	Associate	25047302
Asthenozoospermia	Associate	20711752
Attention Deficit and Disruptive Behavior Disorders	Associate	26228411
Attention Deficit Disorder with Hyperactivity	Associate	28912494
Autism Spectrum Disorder	Associate	18207134, 24814480, 24836510, 25092315, 27015428, 27552585, 27798253, 27843152, 28017919, 28912494, 29309996, 31125951, 31530830, 32127526, 34980886 View all (4 more)
Autistic Disorder	Associate	17383819, 19845972, 19845973, 21208749, 23284802, 23946005, 24367110, 24485488, 27520745, 27552585, 27798253, 27843152, 30918622, 31827587, 31931508, 35316293, 38124130, 38191308 View all (3 more)
Barrett Esophagus	Associate	26406593
Binge Eating Disorder	Associate	36042529
Bipolar Disorder	Stimulate	29940428
Borderline Personality Disorder	Associate	25047302, 25102084, 32580785
Breast Neoplasms	Associate	27857161, 36430579
Breast Neoplasms	Inhibit	33742056
Bulimia	Associate	24621820, 27862641
Bulimia Nervosa	Associate	26106053
Cardiomyopathy Restrictive	Associate	27862641
Chronobiology Disorders	Associate	23786688, 32693857
Cognition Disorders	Associate	23284802, 24814480, 25244972, 26477647, 35672748
Colonic Neoplasms	Associate	32600423
Colorectal Neoplasms	Associate	32235004, 34911835
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29907738
Conversion Disorder	Associate	39236646
Death	Associate	36537264
Dementia Vascular	Stimulate	30990880
Depression Postpartum	Associate	27108164, 30928624, 35462200
Depressive Disorder	Associate	20708845, 25102084, 25262417, 30928624, 35672748
Depressive Disorder	Stimulate	24143878
Depressive Disorder Major	Associate	21208749
Depressive Disorder Major	Stimulate	29940428
Developmental Disabilities	Associate	28912494
Diabetes Mellitus	Associate	28456503
Diabetes Mellitus Type 2	Associate	37047255
Dyskinesia Drug Induced	Associate	38191308
Dysmenorrhea	Associate	20413116, 22999795
Endometriosis	Associate	20413116, 37443771
Esophageal Neoplasms	Associate	33275591
Feeding and Eating Disorders	Associate	24523928, 26106053, 27862641, 36042529
Gestational Weight Gain	Associate	32321883
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16596243
Infarction	Associate	30990880
Infections	Associate	22568870
Infertility Male	Associate	20711752
Inflammation	Inhibit	30990880
Irritable Bowel Syndrome	Associate	19943975, 31833409
Leiomyoma	Associate	17952758, 20056210
Lung Neoplasms	Associate	16043261
Lymphatic Metastasis	Associate	24114056
Mental Disorders	Associate	16470700, 26106053, 26822448, 28017919, 33168330, 35347267, 35688807, 39395443
Mood Disorders	Associate	25092315, 29927293, 35672748
Mouth Diseases	Associate	15831296, 20413116, 33305666
Mucopolysaccharidoses	Associate	35537249
Mucopolysaccharidosis I	Associate	35537249
Mullerian aplasia	Associate	28815558
Myoma	Associate	17952758
Nasal Polyps	Associate	23709377
Neglected Diseases	Associate	32580785, 35672748
Neoplasm Metastasis	Associate	25241033, 32235004, 36045118
Neoplasms	Associate	24238043, 32235004, 36045118
Neuroectodermal Tumors Primitive	Stimulate	24114056
Neuroectodermal Tumors Primitive	Associate	24565507
Neuroendocrine Tumors	Associate	23158174
Neurologic Manifestations	Associate	28017919, 28912494, 38191308
Obesity	Associate	16470700, 17236194, 28456503
Obsessive Compulsive Disorder	Associate	19845972, 27903255, 32631409, 34269138
Obstetric Labor Complications	Associate	37373400
Obstetric Labor Premature	Stimulate	31411323
Oculocutaneous albinism type 2	Associate	28049501
Osteosarcoma	Associate	17367504
Ovarian Cysts	Associate	15831296
Ovarian Neoplasms	Stimulate	26935408
Pain	Associate	33494823
Pancreatic Neoplasms	Associate	31919036
Pediatric Obesity	Associate	28353027, 32580785
Pelvic Pain	Associate	33305666
Peritoneal Diseases	Associate	15831296
Personality Disorders	Associate	31065789
Phobia Social	Associate	20708845, 25563749, 29907738
Polycystic Ovary Syndrome	Associate	37013781
Prader Willi Syndrome	Associate	17236194, 26615966, 35688807
Pre Eclampsia	Associate	31138298
Premature Birth	Associate	34980886, 36788602
Psychological Distress	Associate	31801286
Psychotic Disorders	Associate	31220321, 35688807
Psychotic Disorders	Stimulate	37373400
Respiratory Distress Syndrome	Associate	25564674
Schizophrenia	Associate	23284802, 25244972, 28017919, 31220321
Schizophrenia Disorganized	Associate	23786688
Sexual Trauma	Associate	32580785
Signs and Symptoms Digestive	Associate	19943975
Small Cell Lung Carcinoma	Associate	16043261
Spinal Cord Injuries	Associate	33494823
Squamous Cell Carcinoma of Head and Neck	Associate	36045118
Substance Related Disorders	Associate	23786688, 26822448
Trauma and Stressor Related Disorders	Associate	28353027
Weight Gain	Associate	32321883
Williams Syndrome	Associate	32114409
Wounds and Injuries	Associate	34269138

OXTR (oxytocin receptor)