Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5020
Gene name Gene Name - the full gene name approved by the HGNC.	Oxytocin/neurophysin I prepropeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OXT
Synonyms (NCBI Gene) Gene synonyms aliases	OT, OT-NPI, OXT-NPI
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20p13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Togeth

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ESR1	Unknown	10411324
ESR2	Unknown	10411324
NR2C2	Unknown	17054912

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0002027	Process	Regulation of heart rate	IEA
GO:0002125	Process	Maternal aggressive behavior	IBA
GO:0002125	Process	Maternal aggressive behavior	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005185	Function	Neurohypophyseal hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	TAS	10218979
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007507	Process	Heart development	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007613	Process	Memory	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0010701	Process	Positive regulation of norepinephrine secretion	IEA
GO:0014823	Process	Response to activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0031855	Function	Oxytocin receptor binding	IBA
GO:0031855	Function	Oxytocin receptor binding	IEA
GO:0032094	Process	Response to food	IEA
GO:0032308	Process	Positive regulation of prostaglandin secretion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0033595	Process	Response to genistein	IEA
GO:0034695	Process	Response to prostaglandin E	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035811	Process	Negative regulation of urine volume	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042713	Process	Sperm ejaculation	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045472	Process	Response to ether	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045778	Process	Positive regulation of ossification	IEA
GO:0045925	Process	Positive regulation of female receptivity	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0060179	Process	Male mating behavior	IEA
GO:0060406	Process	Positive regulation of penile erection	IEA
GO:0060450	Process	Positive regulation of hindgut contraction	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IBA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	18071238

MIM	HGNC	e!Ensembl
167050	8528	ENSG00000101405

Protein

UniProt ID

P01178

Protein name

Oxytocin-neurophysin 1 (OT-NPI) [Cleaved into: Oxytocin (Ocytocin); Neurophysin 1]

Protein function

Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR) (PubMed:18174156).

PDB

7OFG , 7OTD , 7QVM , 7RYC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00220	Hormone_4	20 → 28	Neurohypophysial hormones, N-terminal Domain	Family
PF00184	Hormone_5	39 → 116	Neurohypophysial hormones, C-terminal Domain	Family

Sequence

MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
EELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEA
TFSQR

Sequence length

125

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Oxytocin signaling pathway		Vasopressin-like receptors G alpha (q) signalling events

OXT (oxytocin/neurophysin I prepropeptide)