Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5019
Gene name Gene Name - the full gene name approved by the HGNC.	3-oxoacid CoA-transferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OXCT1
Synonyms (NCBI Gene) Gene synonyms aliases	OXCT, SCOT
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A

Show/Hide all(15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs75134564	G>A	Likely-benign, pathogenic, benign	Coding sequence variant, missense variant, non coding transcript variant, genic upstream transcript variant
rs76956231	G>A	Benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, non coding transcript variant, genic upstream transcript variant
rs121909299	G>C	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs121909300	C>A	Pathogenic	Missense variant, non coding transcript variant, downstream transcript variant, coding sequence variant, genic downstream transcript variant
rs121909301	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909302	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121909303	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs144283422	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, non coding transcript variant, synonymous variant, coding sequence variant, genic downstream transcript variant
rs267606930	A>T	Pathogenic	Genic upstream transcript variant, missense variant, coding sequence variant, non coding transcript variant
rs748715820	AA>-,A,AAA,AAAA	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Genic upstream transcript variant, intron variant
rs1327401976	G>A	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant, non coding transcript variant, downstream transcript variant
rs1561081472	C>T	Pathogenic	Intron variant
rs1561128268	C>G	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, genic upstream transcript variant
rs1579884900	G>A	Likely-pathogenic	Non coding transcript variant, stop gained, coding sequence variant, genic upstream transcript variant
rs1579903197	C>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant

Show/Hide all(254)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020769	hsa-miR-155-5p	Proteomics	18668040
MIRT023755	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT029445	hsa-miR-26b-5p	Microarray	19088304
MIRT048474	hsa-miR-100-5p	CLASH	23622248
MIRT1208482	hsa-miR-1305	CLIP-seq
MIRT1208483	hsa-miR-4698	CLIP-seq
MIRT1208484	hsa-miR-607	CLIP-seq
MIRT1208485	hsa-miR-656	CLIP-seq
MIRT2059898	hsa-miR-3117-5p	CLIP-seq
MIRT2059899	hsa-miR-345	CLIP-seq
MIRT2059900	hsa-miR-3545-3p	CLIP-seq
MIRT2059901	hsa-miR-3671	CLIP-seq
MIRT2059902	hsa-miR-4287	CLIP-seq
MIRT2059903	hsa-miR-4420	CLIP-seq
MIRT2059904	hsa-miR-4446-5p	CLIP-seq
MIRT2059905	hsa-miR-4469	CLIP-seq
MIRT2059906	hsa-miR-4522	CLIP-seq
MIRT2059907	hsa-miR-4685-3p	CLIP-seq
MIRT2059908	hsa-miR-4713-5p	CLIP-seq
MIRT2059909	hsa-miR-4762-5p	CLIP-seq
MIRT2059910	hsa-miR-548n	CLIP-seq
MIRT2059911	hsa-miR-548t	CLIP-seq
MIRT1208484	hsa-miR-607	CLIP-seq
MIRT2288227	hsa-miR-1236	CLIP-seq
MIRT2288228	hsa-miR-1248	CLIP-seq
MIRT2288229	hsa-miR-129-3p	CLIP-seq
MIRT2288230	hsa-miR-3123	CLIP-seq
MIRT2288231	hsa-miR-3135	CLIP-seq
MIRT2288232	hsa-miR-337-3p	CLIP-seq
MIRT2288233	hsa-miR-3662	CLIP-seq
MIRT2059901	hsa-miR-3671	CLIP-seq
MIRT2288234	hsa-miR-369-3p	CLIP-seq
MIRT2288235	hsa-miR-374a	CLIP-seq
MIRT2288236	hsa-miR-374b	CLIP-seq
MIRT2288237	hsa-miR-3925-5p	CLIP-seq
MIRT2288238	hsa-miR-4464	CLIP-seq
MIRT2059906	hsa-miR-4522	CLIP-seq
MIRT2288239	hsa-miR-4687-5p	CLIP-seq
MIRT2288240	hsa-miR-4748	CLIP-seq
MIRT2059909	hsa-miR-4762-5p	CLIP-seq
MIRT2288241	hsa-miR-4773	CLIP-seq
MIRT2288242	hsa-miR-586	CLIP-seq
MIRT1208484	hsa-miR-607	CLIP-seq
MIRT2392019	hsa-miR-4521	CLIP-seq
MIRT2288227	hsa-miR-1236	CLIP-seq
MIRT2586333	hsa-miR-124	CLIP-seq
MIRT2288228	hsa-miR-1248	CLIP-seq
MIRT2586334	hsa-miR-1253	CLIP-seq
MIRT2586335	hsa-miR-1261	CLIP-seq
MIRT2586336	hsa-miR-1278	CLIP-seq
MIRT2288229	hsa-miR-129-3p	CLIP-seq
MIRT2586337	hsa-miR-1296	CLIP-seq
MIRT2586338	hsa-miR-147	CLIP-seq
MIRT2586339	hsa-miR-1537	CLIP-seq
MIRT2586340	hsa-miR-2110	CLIP-seq
MIRT2586341	hsa-miR-2277-3p	CLIP-seq
MIRT2586342	hsa-miR-2964a-5p	CLIP-seq
MIRT2586343	hsa-miR-298	CLIP-seq
MIRT2059898	hsa-miR-3117-5p	CLIP-seq
MIRT2586344	hsa-miR-3120-3p	CLIP-seq
MIRT2288230	hsa-miR-3123	CLIP-seq
MIRT2586345	hsa-miR-3125	CLIP-seq
MIRT2586346	hsa-miR-3129-3p	CLIP-seq
MIRT2288231	hsa-miR-3135	CLIP-seq
MIRT2586347	hsa-miR-3137	CLIP-seq
MIRT2586348	hsa-miR-3150a-3p	CLIP-seq
MIRT2586349	hsa-miR-3152-3p	CLIP-seq
MIRT2586350	hsa-miR-3153	CLIP-seq
MIRT2586351	hsa-miR-3154	CLIP-seq
MIRT2586352	hsa-miR-3157-5p	CLIP-seq
MIRT2586353	hsa-miR-330-3p	CLIP-seq
MIRT2288232	hsa-miR-337-3p	CLIP-seq
MIRT2059899	hsa-miR-345	CLIP-seq
MIRT2059900	hsa-miR-3545-3p	CLIP-seq
MIRT2586354	hsa-miR-361-3p	CLIP-seq
MIRT2586355	hsa-miR-3614-3p	CLIP-seq
MIRT2586356	hsa-miR-3650	CLIP-seq
MIRT2586357	hsa-miR-3653	CLIP-seq
MIRT2586358	hsa-miR-3658	CLIP-seq
MIRT2059901	hsa-miR-3671	CLIP-seq
MIRT2586359	hsa-miR-3679-3p	CLIP-seq
MIRT2586360	hsa-miR-3686	CLIP-seq
MIRT2288234	hsa-miR-369-3p	CLIP-seq
MIRT2288235	hsa-miR-374a	CLIP-seq
MIRT2288236	hsa-miR-374b	CLIP-seq
MIRT2586361	hsa-miR-3916	CLIP-seq
MIRT2288237	hsa-miR-3925-5p	CLIP-seq
MIRT2586362	hsa-miR-3929	CLIP-seq
MIRT2586363	hsa-miR-4259	CLIP-seq
MIRT2586364	hsa-miR-4263	CLIP-seq
MIRT2586365	hsa-miR-4271	CLIP-seq
MIRT2586366	hsa-miR-4273	CLIP-seq
MIRT2586367	hsa-miR-4275	CLIP-seq
MIRT2059902	hsa-miR-4287	CLIP-seq
MIRT2586368	hsa-miR-4290	CLIP-seq
MIRT2586369	hsa-miR-4419b	CLIP-seq
MIRT2059903	hsa-miR-4420	CLIP-seq
MIRT2586370	hsa-miR-4422	CLIP-seq
MIRT2586371	hsa-miR-4436a	CLIP-seq
MIRT2059904	hsa-miR-4446-5p	CLIP-seq
MIRT2288238	hsa-miR-4464	CLIP-seq
MIRT2059905	hsa-miR-4469	CLIP-seq
MIRT2586372	hsa-miR-4474-5p	CLIP-seq
MIRT2586373	hsa-miR-4478	CLIP-seq
MIRT2586374	hsa-miR-4484	CLIP-seq
MIRT2586375	hsa-miR-450b-5p	CLIP-seq
MIRT2586376	hsa-miR-451	CLIP-seq
MIRT2586377	hsa-miR-4512	CLIP-seq
MIRT2059906	hsa-miR-4522	CLIP-seq
MIRT2586378	hsa-miR-4646-5p	CLIP-seq
MIRT2586379	hsa-miR-4677-5p	CLIP-seq
MIRT2586380	hsa-miR-4680-3p	CLIP-seq
MIRT2059907	hsa-miR-4685-3p	CLIP-seq
MIRT2586381	hsa-miR-4687-3p	CLIP-seq
MIRT2288239	hsa-miR-4687-5p	CLIP-seq
MIRT2586382	hsa-miR-4691-3p	CLIP-seq
MIRT2586383	hsa-miR-4712-5p	CLIP-seq
MIRT2059908	hsa-miR-4713-5p	CLIP-seq
MIRT2586384	hsa-miR-4715-5p	CLIP-seq
MIRT2586385	hsa-miR-4725-3p	CLIP-seq
MIRT2586386	hsa-miR-4731-3p	CLIP-seq
MIRT2586387	hsa-miR-4747-5p	CLIP-seq
MIRT2288240	hsa-miR-4748	CLIP-seq
MIRT2586388	hsa-miR-4755-5p	CLIP-seq
MIRT2586389	hsa-miR-4759	CLIP-seq
MIRT2059909	hsa-miR-4762-5p	CLIP-seq
MIRT2288241	hsa-miR-4773	CLIP-seq
MIRT2586390	hsa-miR-4801	CLIP-seq
MIRT2586391	hsa-miR-494	CLIP-seq
MIRT2586392	hsa-miR-506	CLIP-seq
MIRT2586393	hsa-miR-518a-5p	CLIP-seq
MIRT2586394	hsa-miR-527	CLIP-seq
MIRT2586395	hsa-miR-548aa	CLIP-seq
MIRT2586396	hsa-miR-548ac	CLIP-seq
MIRT2586397	hsa-miR-548an	CLIP-seq
MIRT2586398	hsa-miR-548c-3p	CLIP-seq
MIRT2586399	hsa-miR-548d-3p	CLIP-seq
MIRT2059910	hsa-miR-548n	CLIP-seq
MIRT2059911	hsa-miR-548t	CLIP-seq
MIRT2586400	hsa-miR-548z	CLIP-seq
MIRT2586401	hsa-miR-562	CLIP-seq
MIRT2586402	hsa-miR-581	CLIP-seq
MIRT2288242	hsa-miR-586	CLIP-seq
MIRT1208484	hsa-miR-607	CLIP-seq
MIRT2586403	hsa-miR-635	CLIP-seq
MIRT2586404	hsa-miR-770-5p	CLIP-seq
MIRT2586405	hsa-miR-889	CLIP-seq
MIRT2586406	hsa-miR-935	CLIP-seq
MIRT2288227	hsa-miR-1236	CLIP-seq
MIRT2586333	hsa-miR-124	CLIP-seq
MIRT2288228	hsa-miR-1248	CLIP-seq
MIRT2586334	hsa-miR-1253	CLIP-seq
MIRT2586335	hsa-miR-1261	CLIP-seq
MIRT2586336	hsa-miR-1278	CLIP-seq
MIRT2288229	hsa-miR-129-3p	CLIP-seq
MIRT2586337	hsa-miR-1296	CLIP-seq
MIRT2586338	hsa-miR-147	CLIP-seq
MIRT2586339	hsa-miR-1537	CLIP-seq
MIRT2586340	hsa-miR-2110	CLIP-seq
MIRT2586341	hsa-miR-2277-3p	CLIP-seq
MIRT2586342	hsa-miR-2964a-5p	CLIP-seq
MIRT2586343	hsa-miR-298	CLIP-seq
MIRT2686926	hsa-miR-3074-5p	CLIP-seq
MIRT2059898	hsa-miR-3117-5p	CLIP-seq
MIRT2586344	hsa-miR-3120-3p	CLIP-seq
MIRT2288230	hsa-miR-3123	CLIP-seq
MIRT2586345	hsa-miR-3125	CLIP-seq
MIRT2586346	hsa-miR-3129-3p	CLIP-seq
MIRT2288231	hsa-miR-3135	CLIP-seq
MIRT2586347	hsa-miR-3137	CLIP-seq
MIRT2586348	hsa-miR-3150a-3p	CLIP-seq
MIRT2586349	hsa-miR-3152-3p	CLIP-seq
MIRT2586350	hsa-miR-3153	CLIP-seq
MIRT2586351	hsa-miR-3154	CLIP-seq
MIRT2586352	hsa-miR-3157-5p	CLIP-seq
MIRT2586353	hsa-miR-330-3p	CLIP-seq
MIRT2288232	hsa-miR-337-3p	CLIP-seq
MIRT2059899	hsa-miR-345	CLIP-seq
MIRT2059900	hsa-miR-3545-3p	CLIP-seq
MIRT2586354	hsa-miR-361-3p	CLIP-seq
MIRT2586355	hsa-miR-3614-3p	CLIP-seq
MIRT2586356	hsa-miR-3650	CLIP-seq
MIRT2586357	hsa-miR-3653	CLIP-seq
MIRT2586358	hsa-miR-3658	CLIP-seq
MIRT2059901	hsa-miR-3671	CLIP-seq
MIRT2586359	hsa-miR-3679-3p	CLIP-seq
MIRT2586360	hsa-miR-3686	CLIP-seq
MIRT2288234	hsa-miR-369-3p	CLIP-seq
MIRT2686927	hsa-miR-370	CLIP-seq
MIRT2288235	hsa-miR-374a	CLIP-seq
MIRT2288236	hsa-miR-374b	CLIP-seq
MIRT2586361	hsa-miR-3916	CLIP-seq
MIRT2288237	hsa-miR-3925-5p	CLIP-seq
MIRT2586362	hsa-miR-3929	CLIP-seq
MIRT2586363	hsa-miR-4259	CLIP-seq
MIRT2586364	hsa-miR-4263	CLIP-seq
MIRT2586365	hsa-miR-4271	CLIP-seq
MIRT2586366	hsa-miR-4273	CLIP-seq
MIRT2586367	hsa-miR-4275	CLIP-seq
MIRT2059902	hsa-miR-4287	CLIP-seq
MIRT2586368	hsa-miR-4290	CLIP-seq
MIRT2586369	hsa-miR-4419b	CLIP-seq
MIRT2059903	hsa-miR-4420	CLIP-seq
MIRT2586370	hsa-miR-4422	CLIP-seq
MIRT2586371	hsa-miR-4436a	CLIP-seq
MIRT2059904	hsa-miR-4446-5p	CLIP-seq
MIRT2288238	hsa-miR-4464	CLIP-seq
MIRT2059905	hsa-miR-4469	CLIP-seq
MIRT2586372	hsa-miR-4474-5p	CLIP-seq
MIRT2586373	hsa-miR-4478	CLIP-seq
MIRT2586374	hsa-miR-4484	CLIP-seq
MIRT2586375	hsa-miR-450b-5p	CLIP-seq
MIRT2586376	hsa-miR-451	CLIP-seq
MIRT2586377	hsa-miR-4512	CLIP-seq
MIRT2059906	hsa-miR-4522	CLIP-seq
MIRT2586378	hsa-miR-4646-5p	CLIP-seq
MIRT2586379	hsa-miR-4677-5p	CLIP-seq
MIRT2586380	hsa-miR-4680-3p	CLIP-seq
MIRT2059907	hsa-miR-4685-3p	CLIP-seq
MIRT2586381	hsa-miR-4687-3p	CLIP-seq
MIRT2288239	hsa-miR-4687-5p	CLIP-seq
MIRT2586382	hsa-miR-4691-3p	CLIP-seq
MIRT2586383	hsa-miR-4712-5p	CLIP-seq
MIRT2059908	hsa-miR-4713-5p	CLIP-seq
MIRT2586384	hsa-miR-4715-5p	CLIP-seq
MIRT2586385	hsa-miR-4725-3p	CLIP-seq
MIRT2586386	hsa-miR-4731-3p	CLIP-seq
MIRT2586387	hsa-miR-4747-5p	CLIP-seq
MIRT2288240	hsa-miR-4748	CLIP-seq
MIRT2586388	hsa-miR-4755-5p	CLIP-seq
MIRT2586389	hsa-miR-4759	CLIP-seq
MIRT2059909	hsa-miR-4762-5p	CLIP-seq
MIRT2288241	hsa-miR-4773	CLIP-seq
MIRT2586390	hsa-miR-4801	CLIP-seq
MIRT2586391	hsa-miR-494	CLIP-seq
MIRT2586392	hsa-miR-506	CLIP-seq
MIRT2586393	hsa-miR-518a-5p	CLIP-seq
MIRT2586394	hsa-miR-527	CLIP-seq
MIRT2586395	hsa-miR-548aa	CLIP-seq
MIRT2586396	hsa-miR-548ac	CLIP-seq
MIRT2586397	hsa-miR-548an	CLIP-seq
MIRT2586398	hsa-miR-548c-3p	CLIP-seq
MIRT2586399	hsa-miR-548d-3p	CLIP-seq
MIRT2059910	hsa-miR-548n	CLIP-seq
MIRT2059911	hsa-miR-548t	CLIP-seq
MIRT2586400	hsa-miR-548z	CLIP-seq
MIRT2586401	hsa-miR-562	CLIP-seq
MIRT2586402	hsa-miR-581	CLIP-seq
MIRT2288242	hsa-miR-586	CLIP-seq
MIRT1208484	hsa-miR-607	CLIP-seq
MIRT2586403	hsa-miR-635	CLIP-seq
MIRT2586404	hsa-miR-770-5p	CLIP-seq
MIRT2586405	hsa-miR-889	CLIP-seq
MIRT2586406	hsa-miR-935	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	11756565
GO:0005739	Component	Mitochondrion	NAS	10964512
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0007420	Process	Brain development	IEA
GO:0007507	Process	Heart development	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008260	Function	3-oxoacid CoA-transferase activity	IBA	21873635
GO:0008260	Function	3-oxoacid CoA-transferase activity	IMP	8751852, 10964512
GO:0008410	Function	CoA-transferase activity	IBA	21873635
GO:0009725	Process	Response to hormone	IEA
GO:0014823	Process	Response to activity	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042182	Process	Ketone catabolic process	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046950	Process	Cellular ketone body metabolic process	IBA	21873635
GO:0046950	Process	Cellular ketone body metabolic process	IMP	9671268
GO:0046952	Process	Ketone body catabolic process	TAS
GO:0060612	Process	Adipose tissue development	IEA

MIM	HGNC	e!Ensembl
601424	8527	ENSG00000083720

Protein

UniProt ID

P55809

Protein name

Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial (SCOT) (EC 2.8.3.5) (3-oxoacid CoA-transferase 1) (Somatic-type succinyl-CoA:3-oxoacid CoA-transferase) (SCOT-s) (Succinyl-CoA:3-oxoacid CoA transferase)

Protein function

Key enzyme for ketone body catabolism. Catalyzes the first, rate-limiting step of ketone body utilization in extrahepatic tissues, by transferring coenzyme A (CoA) from a donor thiolester species (succinyl-CoA) to an acceptor carboxylate (acetoa

PDB

3DLX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01144	CoA_trans	43 → 272	Coenzyme A transferase	Domain
PF01144	CoA_trans	302 → 501	Coenzyme A transferase	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundant in heart, followed in order by brain, kidney, skeletal muscle, and lung, whereas in liver it is undetectable. Expressed (at protein level) in all tissues (except in liver), most abundant in myocardium, then brain, kidney, adre

Sequence

MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Valine, leucine and isoleucine degradation Butanoate metabolism Metabolic pathways		Utilization of Ketone Bodies

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Osteoporosis	Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	18924182
Succinyl-coa acetoacetate transferase deficiency	Succinyl-CoA:3-oxoacid CoA transferase deficiency	rs121909299, rs121909300, rs121909301, rs121909302, rs1561081472, rs202242762, rs1561128268, rs1327401976, rs1579903197, rs1579884900	9671268, 10964512, 21296660, 31216074, 23420214

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Succinyl-CoA Acetoacetate Transferase Deficiency	succinyl-CoA:3-ketoacid CoA transferase deficiency	GenCC
Bipolar Disorder	Bipolar Disorder	GWAS
Ketonuria	Ketonuria	GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	35482822
Aortic Aneurysm Thoracic	Inhibit	37193023
Aortic Dissection	Associate	37193023
Carcinoma Hepatocellular	Associate	36308411, 38176415
Carcinoma Non Small Cell Lung	Associate	35482822
Diabetes Mellitus	Associate	19296078
Diabetes Mellitus Type 2	Associate	19296078
Diabetic Cardiomyopathies	Associate	38160540
Dissection Thoracic Aorta	Inhibit	37193023
Hepatoblastoma	Associate	39684755
Ketosis	Associate	30799594, 9083111
Metabolic Diseases	Associate	9083111
Methylcobalamin Deficiency CblG Type	Inhibit	38168585
Nasopharyngeal Carcinoma	Associate	40083932
Neoplasms	Associate	35482822, 38176415, 39684755, 40634657
Osteosarcoma	Associate	35191809
Prostatic Neoplasms	Associate	23443136
Sjogren's Syndrome	Associate	29504848
Stomach Neoplasms	Associate	15330163
Succinyl CoA:3 oxoacid CoA transferase deficiency	Associate	30799594, 8751852
Thoracic Diseases	Associate	37193023
Thymoma	Associate	30787364
Triple Negative Breast Neoplasms	Associate	40634657

OXCT1 (3-oxoacid CoA-transferase 1)