Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5017
Gene name Gene Name - the full gene name approved by the HGNC.
Ovo like transcriptional repressor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OVOL1
Synonyms (NCBI Gene) Gene synonyms aliases
HOVO1
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT026823 hsa-miR-192-5p Microarray 19074876
MIRT723188 hsa-miR-8485 HITS-CLIP 19536157
MIRT723187 hsa-miR-4519 HITS-CLIP 19536157
MIRT723186 hsa-miR-148a-3p HITS-CLIP 19536157
MIRT723185 hsa-miR-148b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
GO:0001822 Process Kidney development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602313 8525 ENSG00000172818
Protein
UniProt ID O14753
Protein name Putative transcription factor Ovo-like 1 (hOvo1)
Protein function Putative transcription factor. Involved in hair formation and spermatogenesis. May function in the differentiation and/or maintenance of the urogenital system (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 118 140 Zinc finger, C2H2 type Domain
PF13465 zf-H2C2_2 160 185 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
Sequence
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLA
LNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC
RVCQKAFTYQRMLNRHMKCH
NDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQ
RCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP
LLRKTSKKVAVALQNTVTSLLQGSPHL
Sequence length 267
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 23042114, 26482879
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 31619474 ClinVar, GWAS
Eczema Eczema GWAS
Breast cancer Breast cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acne Vulgaris Associate 24927181
Alopecia Associate 26873447
Asthma Associate 33710309
Bowen's Disease Stimulate 28339425
Breast Neoplasms Inhibit 35484112
Breast Neoplasms Associate 37950222
Carcinoma Renal Cell Associate 22430804
Carcinoma Squamous Cell Inhibit 28339425
Carcinoma Squamous Cell Associate 29749538
Dermatitis Atopic Associate 28703805