Gene Gene information from NCBI Gene database.
Entrez ID 5017
Gene name Ovo like transcriptional repressor 1
Gene symbol OVOL1
Synonyms (NCBI Gene)
HOVO1
Chromosome 11
Chromosome location 11q13.1
Summary This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis
miRNA miRNA information provided by mirtarbase database.
309
miRTarBase ID miRNA Experiments Reference
MIRT026823 hsa-miR-192-5p Microarray 19074876
MIRT723188 hsa-miR-8485 HITS-CLIP 19536157
MIRT723187 hsa-miR-4519 HITS-CLIP 19536157
MIRT723186 hsa-miR-148a-3p HITS-CLIP 19536157
MIRT723185 hsa-miR-148b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602313 8525 ENSG00000172818
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14753
Protein name Putative transcription factor Ovo-like 1 (hOvo1)
Protein function Putative transcription factor. Involved in hair formation and spermatogenesis. May function in the differentiation and/or maintenance of the urogenital system (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 118 140 Zinc finger, C2H2 type Domain
PF13465 zf-H2C2_2 160 185 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
Sequence
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLA
LNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC
RVCQKAFTYQRMLNRHMKCH
NDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD
KAFTQ
RCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP
LLRKTSKKVAVALQNTVTSLLQGSPHL
Sequence length 267
Interactions View interactions