Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5013
Gene name	Orthodenticle homeobox 1
Gene symbol	OTX1
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p15
Summary	This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for

243

Show/Hide all (243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020057	hsa-miR-375	Microarray	20215506
MIRT509250	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509249	hsa-miR-455-5p	HITS-CLIP	21572407
MIRT509248	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	HITS-CLIP	21572407
MIRT509246	hsa-miR-4718	HITS-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	HITS-CLIP	21572407
MIRT509244	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509242	hsa-miR-3924	HITS-CLIP	21572407
MIRT522048	hsa-miR-6083	HITS-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT509249	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT509248	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	20371350
MIRT509246	hsa-miR-4718	PAR-CLIP	20371350
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	20371350
MIRT509244	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT509242	hsa-miR-3924	PAR-CLIP	20371350
MIRT522048	hsa-miR-6083	PAR-CLIP	20371350
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT550914	hsa-miR-200a-5p	PAR-CLIP	21572407
MIRT550913	hsa-miR-200b-5p	PAR-CLIP	21572407
MIRT509249	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT509248	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550912	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT509246	hsa-miR-4718	PAR-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT550911	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT509244	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509242	hsa-miR-3924	PAR-CLIP	21572407
MIRT522048	hsa-miR-6083	PAR-CLIP	21572407
MIRT550910	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509249	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT509248	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT509246	hsa-miR-4718	PAR-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT509244	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509242	hsa-miR-3924	PAR-CLIP	21572407
MIRT522048	hsa-miR-6083	PAR-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509249	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT509248	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	23446348
MIRT509246	hsa-miR-4718	PAR-CLIP	23446348
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	23446348
MIRT509244	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509242	hsa-miR-3924	PAR-CLIP	23446348
MIRT522048	hsa-miR-6083	PAR-CLIP	23446348
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509249	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT509248	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	23446348
MIRT509246	hsa-miR-4718	PAR-CLIP	23446348
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	23446348
MIRT509244	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509242	hsa-miR-3924	PAR-CLIP	23446348
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT733404	hsa-miR-4516	Immunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	32549762
MIRT509250	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509249	hsa-miR-455-5p	HITS-CLIP	21572407
MIRT509248	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	HITS-CLIP	21572407
MIRT509246	hsa-miR-4718	HITS-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	HITS-CLIP	21572407
MIRT509244	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509242	hsa-miR-3924	HITS-CLIP	21572407
MIRT522048	hsa-miR-6083	HITS-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT509249	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT509248	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	20371350
MIRT509246	hsa-miR-4718	PAR-CLIP	20371350
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	20371350
MIRT509244	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT509242	hsa-miR-3924	PAR-CLIP	20371350
MIRT522048	hsa-miR-6083	PAR-CLIP	20371350
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT550914	hsa-miR-200a-5p	PAR-CLIP	21572407
MIRT550913	hsa-miR-200b-5p	PAR-CLIP	21572407
MIRT509249	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT509248	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT550912	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT509246	hsa-miR-4718	PAR-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT550911	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT509244	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509242	hsa-miR-3924	PAR-CLIP	21572407
MIRT522048	hsa-miR-6083	PAR-CLIP	21572407
MIRT550910	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509249	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT509248	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT509246	hsa-miR-4718	PAR-CLIP	21572407
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT509244	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509242	hsa-miR-3924	PAR-CLIP	21572407
MIRT522048	hsa-miR-6083	PAR-CLIP	21572407
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509249	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT509248	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	23446348
MIRT509246	hsa-miR-4718	PAR-CLIP	23446348
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	23446348
MIRT509244	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509242	hsa-miR-3924	PAR-CLIP	23446348
MIRT522048	hsa-miR-6083	PAR-CLIP	23446348
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT509250	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509249	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT509248	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT509247	hsa-miR-1537-5p	PAR-CLIP	23446348
MIRT509246	hsa-miR-4718	PAR-CLIP	23446348
MIRT509245	hsa-miR-4999-5p	PAR-CLIP	23446348
MIRT509244	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT509243	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509242	hsa-miR-3924	PAR-CLIP	23446348
MIRT509241	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1208217	hsa-miR-1343	CLIP-seq
MIRT1208218	hsa-miR-140-5p	CLIP-seq
MIRT1208219	hsa-miR-2052	CLIP-seq
MIRT1208220	hsa-miR-3074-5p	CLIP-seq
MIRT1208221	hsa-miR-3545-5p	CLIP-seq
MIRT1208222	hsa-miR-3617	CLIP-seq
MIRT1208223	hsa-miR-4460	CLIP-seq
MIRT1208224	hsa-miR-4639-5p	CLIP-seq
MIRT1208225	hsa-miR-4652-3p	CLIP-seq
MIRT1208226	hsa-miR-4680-5p	CLIP-seq
MIRT1208227	hsa-miR-4727-3p	CLIP-seq
MIRT1208228	hsa-miR-641	CLIP-seq
MIRT1208229	hsa-miR-103a	CLIP-seq
MIRT1208230	hsa-miR-106a	CLIP-seq
MIRT1208231	hsa-miR-106b	CLIP-seq
MIRT1208232	hsa-miR-107	CLIP-seq
MIRT1208233	hsa-miR-1253	CLIP-seq
MIRT1208218	hsa-miR-140-5p	CLIP-seq
MIRT1208234	hsa-miR-1587	CLIP-seq
MIRT1208235	hsa-miR-15a	CLIP-seq
MIRT1208236	hsa-miR-15b	CLIP-seq
MIRT1208237	hsa-miR-16	CLIP-seq
MIRT1208238	hsa-miR-17	CLIP-seq
MIRT1208239	hsa-miR-184	CLIP-seq
MIRT1208240	hsa-miR-186	CLIP-seq
MIRT1208241	hsa-miR-195	CLIP-seq
MIRT1208242	hsa-miR-196a	CLIP-seq
MIRT1208243	hsa-miR-196b	CLIP-seq
MIRT1208244	hsa-miR-198	CLIP-seq
MIRT1208219	hsa-miR-2052	CLIP-seq
MIRT1208245	hsa-miR-20a	CLIP-seq
MIRT1208246	hsa-miR-20b	CLIP-seq
MIRT1208247	hsa-miR-2278	CLIP-seq
MIRT1208248	hsa-miR-2861	CLIP-seq
MIRT1208249	hsa-miR-298	CLIP-seq
MIRT1208250	hsa-miR-3147	CLIP-seq
MIRT1208251	hsa-miR-3154	CLIP-seq
MIRT1208252	hsa-miR-3179	CLIP-seq
MIRT1208253	hsa-miR-3191	CLIP-seq
MIRT1208254	hsa-miR-3198	CLIP-seq
MIRT1208221	hsa-miR-3545-5p	CLIP-seq
MIRT1208255	hsa-miR-3609	CLIP-seq
MIRT1208256	hsa-miR-3611	CLIP-seq
MIRT1208257	hsa-miR-369-3p	CLIP-seq
MIRT1208258	hsa-miR-371-5p	CLIP-seq
MIRT1208259	hsa-miR-383	CLIP-seq
MIRT1208260	hsa-miR-3928	CLIP-seq
MIRT1208261	hsa-miR-3944-5p	CLIP-seq
MIRT1208262	hsa-miR-424	CLIP-seq
MIRT1208263	hsa-miR-4260	CLIP-seq
MIRT1208264	hsa-miR-4309	CLIP-seq
MIRT1208265	hsa-miR-4311	CLIP-seq
MIRT1208266	hsa-miR-4419a	CLIP-seq
MIRT1208267	hsa-miR-4425	CLIP-seq
MIRT1208268	hsa-miR-4434	CLIP-seq
MIRT1208269	hsa-miR-4437	CLIP-seq
MIRT1208223	hsa-miR-4460	CLIP-seq
MIRT1208270	hsa-miR-4468	CLIP-seq
MIRT1208271	hsa-miR-4510	CLIP-seq
MIRT1208272	hsa-miR-4656	CLIP-seq
MIRT1208273	hsa-miR-4672	CLIP-seq
MIRT1208274	hsa-miR-4674	CLIP-seq
MIRT1208226	hsa-miR-4680-5p	CLIP-seq
MIRT1208275	hsa-miR-4688	CLIP-seq
MIRT1208276	hsa-miR-4703-3p	CLIP-seq
MIRT1208277	hsa-miR-4716-3p	CLIP-seq
MIRT1208227	hsa-miR-4727-3p	CLIP-seq
MIRT1208278	hsa-miR-4746-3p	CLIP-seq
MIRT1208279	hsa-miR-4767	CLIP-seq
MIRT1208280	hsa-miR-4796-3p	CLIP-seq
MIRT1208281	hsa-miR-488	CLIP-seq
MIRT1208282	hsa-miR-497	CLIP-seq
MIRT1208283	hsa-miR-519d	CLIP-seq
MIRT1208284	hsa-miR-548ah	CLIP-seq
MIRT1208285	hsa-miR-571	CLIP-seq
MIRT1208286	hsa-miR-576-3p	CLIP-seq
MIRT1208287	hsa-miR-609	CLIP-seq
MIRT1208288	hsa-miR-625	CLIP-seq
MIRT1208289	hsa-miR-629	CLIP-seq
MIRT1208290	hsa-miR-653	CLIP-seq
MIRT1208291	hsa-miR-661	CLIP-seq
MIRT1208292	hsa-miR-93	CLIP-seq
MIRT2059835	hsa-miR-507	CLIP-seq
MIRT2059836	hsa-miR-557	CLIP-seq
MIRT1208218	hsa-miR-140-5p	CLIP-seq
MIRT1208219	hsa-miR-2052	CLIP-seq
MIRT1208221	hsa-miR-3545-5p	CLIP-seq
MIRT1208260	hsa-miR-3928	CLIP-seq
MIRT1208223	hsa-miR-4460	CLIP-seq
MIRT1208226	hsa-miR-4680-5p	CLIP-seq
MIRT1208227	hsa-miR-4727-3p	CLIP-seq
MIRT2392000	hsa-miR-1276	CLIP-seq
MIRT2392001	hsa-miR-3199	CLIP-seq
MIRT2392002	hsa-miR-3935	CLIP-seq
MIRT1208265	hsa-miR-4311	CLIP-seq
MIRT2392003	hsa-miR-4652-5p	CLIP-seq
MIRT1208277	hsa-miR-4716-3p	CLIP-seq
MIRT2392004	hsa-miR-4779	CLIP-seq
MIRT2392005	hsa-miR-577	CLIP-seq
MIRT2392006	hsa-miR-583	CLIP-seq
MIRT2392007	hsa-miR-765	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18849347
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	18849347
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19447967, 21516116, 25416956, 25910212, 27107012, 29892012, 30886144, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0022037	Process	Metencephalon development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18849347
GO:0048852	Process	Diencephalon morphogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600036	8521	ENSG00000115507

P32242

Protein name

Homeobox protein OTX1 (Orthodenticle homolog 1)

Protein function

Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	39 → 95	Homeodomain	Domain
PF03529	TF_Otx	178 → 279	Otx1 transcription factor	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. Detected in the anterior part of the neural fetal retina (at protein level). {ECO:0000269|PubMed:19414065}.

Sequence

MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSG
SESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPA
SISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSS
SYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH
HQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL

Sequence length

354

Interactions

View interactions

	KEGG
	Signaling pathways regulating pluripotency of stem cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTX1-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESICOURETERAL REFLUX	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	22143938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	33015792	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	37779184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Stimulate	36177903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	21750575	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	21750575	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Stimulate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Associate	26953815	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	33336731	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	33015792	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	31194719, 39331921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	22143938, 34306176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37779184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Communication Disorders	Associate	21750575	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esthesioneuroblastoma Olfactory	Associate	28348423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	26406991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	31526458	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	33883344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	33883344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Stimulate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Stimulate	19893048, 24832791	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	30066897	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26953815, 28348423, 30066897, 33015792, 36177903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	32484209	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive Transformation of Germinal Centers	Associate	19893048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Associate	15215745	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Associate	28348423	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	30066897, 32419651	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Stimulate	36177903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Associate	24227910	★★★★★ ★☆☆☆☆ Found in Text Mining only

OTX1 (orthodenticle homeobox 1)