OSM (oncostatin M)

Gene

• Entrez ID: 5008
• Gene name: Oncostatin M
• Gene symbol: OSM
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1206723	hsa-miR-1231	CLIP-seq
MIRT1206724	hsa-miR-1302	CLIP-seq
MIRT1206725	hsa-miR-193a-5p	CLIP-seq
MIRT1206726	hsa-miR-3122	CLIP-seq
MIRT1206727	hsa-miR-3140-3p	CLIP-seq
MIRT1206728	hsa-miR-3163	CLIP-seq
MIRT1206729	hsa-miR-3192	CLIP-seq
MIRT1206730	hsa-miR-340	CLIP-seq
MIRT1206731	hsa-miR-3689a-3p	CLIP-seq
MIRT1206732	hsa-miR-3689c	CLIP-seq
MIRT1206733	hsa-miR-3689d	CLIP-seq
MIRT1206734	hsa-miR-3913-5p	CLIP-seq
MIRT1206735	hsa-miR-3934	CLIP-seq
MIRT1206736	hsa-miR-4298	CLIP-seq
MIRT1206737	hsa-miR-4527	CLIP-seq
MIRT1206738	hsa-miR-4728-5p	CLIP-seq
MIRT1206739	hsa-miR-548a-3p	CLIP-seq
MIRT1206740	hsa-miR-548c-3p	CLIP-seq
MIRT1206741	hsa-miR-548e	CLIP-seq
MIRT1206742	hsa-miR-548f	CLIP-seq
MIRT2287851	hsa-miR-106a	CLIP-seq
MIRT2287852	hsa-miR-106b	CLIP-seq
MIRT2287853	hsa-miR-17	CLIP-seq
MIRT2287854	hsa-miR-20a	CLIP-seq
MIRT2287855	hsa-miR-20b	CLIP-seq
MIRT2287856	hsa-miR-3176	CLIP-seq
MIRT2287857	hsa-miR-3609	CLIP-seq
MIRT2287858	hsa-miR-3649	CLIP-seq
MIRT2287859	hsa-miR-3661	CLIP-seq
MIRT2287860	hsa-miR-3670	CLIP-seq
MIRT2287861	hsa-miR-3922-3p	CLIP-seq
MIRT2287862	hsa-miR-4492	CLIP-seq
MIRT2287863	hsa-miR-4498	CLIP-seq
MIRT2287864	hsa-miR-4508	CLIP-seq
MIRT2287865	hsa-miR-4796-3p	CLIP-seq
MIRT2287866	hsa-miR-492	CLIP-seq
MIRT2287867	hsa-miR-519d	CLIP-seq
MIRT2287868	hsa-miR-548ah	CLIP-seq
MIRT2287869	hsa-miR-631	CLIP-seq
MIRT2287870	hsa-miR-661	CLIP-seq
MIRT2287871	hsa-miR-762	CLIP-seq
MIRT2287872	hsa-miR-93	CLIP-seq
MIRT2287873	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	10391682

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002675	Process	Positive regulation of acute inflammatory response	IC	8999038
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	8999038
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	2779549
GO:0005147	Function	Oncostatin-M receptor binding	IEA
GO:0005147	Function	Oncostatin-M receptor binding	IPI	8999038
GO:0005147	Function	Oncostatin-M receptor binding	TAS	9920829
GO:0005515	Function	Protein binding	IPI	16051226, 28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2779549
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IDA	8999038
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8999038
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1717982
GO:0010646	Process	Regulation of cell communication	IEA
GO:0023051	Process	Regulation of signaling	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	28972028
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0038165	Process	Oncostatin-M-mediated signaling pathway	IDA	8999038, 28972028
GO:0038165	Process	Oncostatin-M-mediated signaling pathway	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0050729	Process	Positive regulation of inflammatory response	IDA	28972028
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	28972028
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS	1542793

Other IDs

• MIM: 165095
• HGNC: 8506
• e!Ensembl: ENSG00000099985

Protein

• UniProt ID: P13725
• Protein name: Oncostatin-M (OSM)
• Protein function: Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (he
• PDB: 1EVS, 8V29, 8V2A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01291	LIF_OSM	37 → 209	LIF / OSM family	Domain

• Sequence:

  MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
  RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
  QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
  ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
  GKRLMTRGQLPR

• Sequence length: 252

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
JAK-STAT signaling pathway

Reactome:

Interleukin-4 and Interleukin-13 signaling
IL-6-type cytokine receptor ligand interactions