Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5008
Gene name Gene Name - the full gene name approved by the HGNC.	Oncostatin M
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OSM
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that in

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments
MIRT1206723	hsa-miR-1231	CLIP-seq
MIRT1206724	hsa-miR-1302	CLIP-seq
MIRT1206725	hsa-miR-193a-5p	CLIP-seq
MIRT1206726	hsa-miR-3122	CLIP-seq
MIRT1206727	hsa-miR-3140-3p	CLIP-seq
MIRT1206728	hsa-miR-3163	CLIP-seq
MIRT1206729	hsa-miR-3192	CLIP-seq
MIRT1206730	hsa-miR-340	CLIP-seq
MIRT1206731	hsa-miR-3689a-3p	CLIP-seq
MIRT1206732	hsa-miR-3689c	CLIP-seq
MIRT1206733	hsa-miR-3689d	CLIP-seq
MIRT1206734	hsa-miR-3913-5p	CLIP-seq
MIRT1206735	hsa-miR-3934	CLIP-seq
MIRT1206736	hsa-miR-4298	CLIP-seq
MIRT1206737	hsa-miR-4527	CLIP-seq
MIRT1206738	hsa-miR-4728-5p	CLIP-seq
MIRT1206739	hsa-miR-548a-3p	CLIP-seq
MIRT1206740	hsa-miR-548c-3p	CLIP-seq
MIRT1206741	hsa-miR-548e	CLIP-seq
MIRT1206742	hsa-miR-548f	CLIP-seq
MIRT2287851	hsa-miR-106a	CLIP-seq
MIRT2287852	hsa-miR-106b	CLIP-seq
MIRT2287853	hsa-miR-17	CLIP-seq
MIRT2287854	hsa-miR-20a	CLIP-seq
MIRT2287855	hsa-miR-20b	CLIP-seq
MIRT2287856	hsa-miR-3176	CLIP-seq
MIRT2287857	hsa-miR-3609	CLIP-seq
MIRT2287858	hsa-miR-3649	CLIP-seq
MIRT2287859	hsa-miR-3661	CLIP-seq
MIRT2287860	hsa-miR-3670	CLIP-seq
MIRT2287861	hsa-miR-3922-3p	CLIP-seq
MIRT2287862	hsa-miR-4492	CLIP-seq
MIRT2287863	hsa-miR-4498	CLIP-seq
MIRT2287864	hsa-miR-4508	CLIP-seq
MIRT2287865	hsa-miR-4796-3p	CLIP-seq
MIRT2287866	hsa-miR-492	CLIP-seq
MIRT2287867	hsa-miR-519d	CLIP-seq
MIRT2287868	hsa-miR-548ah	CLIP-seq
MIRT2287869	hsa-miR-631	CLIP-seq
MIRT2287870	hsa-miR-661	CLIP-seq
MIRT2287871	hsa-miR-762	CLIP-seq
MIRT2287872	hsa-miR-93	CLIP-seq
MIRT2287873	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT3	Activation	10391682

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002675	Process	Positive regulation of acute inflammatory response	IC	8999038
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	8999038
GO:0005147	Function	Oncostatin-M receptor binding	IPI	8999038
GO:0005515	Function	Protein binding	IPI	16051226, 28514442
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	IEA
GO:0007275	Process	Multicellular organism development	TAS	1717982
GO:0008083	Function	Growth factor activity	IDA	8999038
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8999038
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1717982
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IGI	28972028
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	28972028
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0038165	Process	Oncostatin-M-mediated signaling pathway	IDA	8999038
GO:0040008	Process	Regulation of growth	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0050729	Process	Positive regulation of inflammatory response	IDA	28972028
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917, 8999038
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IGI	28972028
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS	1542793

MIM	HGNC	e!Ensembl
165095	8506	ENSG00000099985

Protein

UniProt ID

P13725

Protein name

Oncostatin-M (OSM)

Protein function

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (he

PDB

1EVS , 8V29 , 8V2A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01291	LIF_OSM	37 → 209	LIF / OSM family	Domain

Sequence

MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR

Sequence length

252

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway JAK-STAT signaling pathway		Interleukin-4 and Interleukin-13 signaling IL-6-type cytokine receptor ligand interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Coronary artery disease	Coronary artery disease	GWAS
Myocardial Infarction	Myocardial Infarction	GWAS

Show/Hide Text Mining Associations (85)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	10590238, 7657807, 8030759
Adenocarcinoma of Lung	Inhibit	27486982
Adenocarcinoma of Lung	Associate	40486872
AIDS related Kaposi sarcoma	Associate	7657807
Amyotrophic Lateral Sclerosis	Stimulate	40306441
Aortic Aneurysm Abdominal	Associate	17321344
Arthritis Psoriatic	Associate	16917497
Arthritis Rheumatoid	Associate	10632674, 15146412, 17009243, 19565514, 19627579, 32561292
Asthma	Stimulate	19916861
Astrocytoma	Associate	11284716, 25246098
Atherosclerosis	Associate	24307759, 28471981
Atrial Fibrillation	Associate	28471981
Blood Coagulation Disorders	Stimulate	19652200
Breast Neoplasms	Associate	28106823, 31036052, 34011405
Carcinogenesis	Inhibit	34037532
Carcinoma Ductal	Associate	34011405
Carcinoma Hepatocellular	Associate	15240818
Carcinoma Hepatocellular	Inhibit	23621231
Carcinoma Pancreatic Ductal	Associate	36495330
Carcinoma Squamous Cell	Associate	33057049
Cardiovascular Diseases	Associate	31548569
Cartilage Diseases	Associate	17009243
Cerebral Infarction	Stimulate	35686557
Common Variable Immunodeficiency	Stimulate	34146579
Conjunctivitis Allergic	Associate	36580308
COVID 19	Associate	35286852
Depressive Disorder	Associate	32998701
Enterocolitis	Associate	33891982
Epilepsy Post Traumatic	Inhibit	38557165
Esophageal Neoplasms	Associate	40198992
Fibrosis	Associate	12905481, 32736577, 35682987
Gastro enteropancreatic neuroendocrine tumor	Associate	34037532
Glioblastoma	Inhibit	10936178, 16818624
Glioblastoma	Associate	25748242, 28351321
Glioma	Associate	25748242
Heart Diseases	Associate	37047067
Hypereosinophilic Syndrome	Associate	25840724
Idiopathic Pulmonary Fibrosis	Associate	30221703
IgA Vasculitis	Associate	21548952
Infections	Associate	39591472
Inflammation	Inhibit	10899931
Inflammation	Stimulate	12514595, 17321344
Inflammation	Associate	19916861, 25054142, 25622278, 32788292, 33891982, 34224783, 35193419, 39513097, 39591472, 8898888
Inflammatory Bowel Diseases	Associate	33201212, 33624092, 34843732
Joint Diseases	Associate	15146412
Lung Diseases	Associate	12905481
Lung Injury	Associate	16684952
Lymphatic Metastasis	Stimulate	40198992
Lymphoma Large B Cell Diffuse	Associate	3540948
Lysosomal Storage Diseases	Associate	39320136
Mastocytosis Systemic	Associate	21457934
Melanoma	Inhibit	11399520
Methylmalonic Aciduria due to Methylmalonyl CoA Mutase Deficiency	Associate	40486872
Multiple Myeloma	Associate	8145045, 8916964
Muscular Dystrophy Duchenne	Associate	40724841
Nasal Polyps	Associate	35682987, 37047067
Neoplasm Metastasis	Associate	21975934, 25622278, 34011405
Neoplasm Metastasis	Inhibit	34037532
Neoplasms	Associate	10751416, 17386023, 21975934, 25622278, 26446994, 31036052, 34477239, 37164949, 37682817, 39593161, 40198992, 8030759
Neoplasms	Inhibit	16818624, 31548569, 3540948
Neoplasms	Stimulate	27892764
Osteoarthritis	Associate	10632674
Pain	Associate	22337942
Periodontitis	Stimulate	39513097
Plasmacytoma	Associate	8145046
Platelet Glycoprotein IV Deficiency	Associate	40450010
Polycythemia Vera	Associate	39320136
Psoriasis	Associate	16917497, 34992498
Pulmonary Disease Chronic Obstructive	Stimulate	19916861, 21483784
Pulmonary Disease Chronic Obstructive	Associate	40343765
Rupture	Stimulate	22337942
Sarcoidosis	Associate	33923774
Sarcoma Kaposi	Associate	10590238, 12531804, 7657807, 7688764, 7887453, 8030759, 8669484
Scleroderma Systemic	Associate	12905481
Skin Neoplasms	Associate	37164949
Squamous Cell Carcinoma of Head and Neck	Associate	29385191
Status Asthmaticus	Stimulate	19916861
Stomach Diseases	Associate	34037532
Stomach Neoplasms	Associate	33851342
Tendinopathy	Associate	22337942
Thrombosis	Associate	28471981
Tn Syndrome	Associate	33232439
Triple Negative Breast Neoplasms	Associate	31036052, 39593161
Vascular Diseases	Associate	19652200
Xeroderma Pigmentosum	Associate	7688764

OSM (oncostatin M)