Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5004
Gene name Gene Name - the full gene name approved by the HGNC.	Orosomucoid 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ORM1
Synonyms (NCBI Gene) Gene synonyms aliases	A1AG1, AGP-A, AGP1, HEL-S-153w, ORM
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT734893	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16272158, 28514442, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509, 27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8774350
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	3360326
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2822385
GO:0006954	Process	Inflammatory response	TAS	3360326
GO:0031093	Component	Platelet alpha granule lumen	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	23973664
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	23973664
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	8774350
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8774350
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0035580	Component	Specific granule lumen	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
138600	8498	ENSG00000229314

Protein

UniProt ID

P02763

Protein name

Alpha-1-acid glycoprotein 1 (AGP 1) (Orosomucoid-1) (OMD 1)

Protein function

Functions as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating t

PDB

3KQ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	40 → 180	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by the liver and secreted in plasma.

Sequence

MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES

Sequence length

201

Interactions

View interactions

	Reactome
			Platelet degranulation Neutrophil degranulation

ORM1 (orosomucoid 1)