OPRD1 (opioid receptor delta 1)

Gene

• Entrez ID: 4985
• Gene name: Opioid receptor delta 1
• Gene symbol: OPRD1
• Synonyms (NCBI Gene): DOP, DOR, DOR1, OPRD
• Chromosome: 1
• Chromosome location: 1p35.3

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs678849	C>G,T	Drug-response	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037618	hsa-miR-744-5p	CLASH	23622248
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT1204460	hsa-miR-3909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	IDA	22184124
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15086532, 20528919, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22184124
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7808419, 10788493
GO:0006955	Process	Immune response	TAS	9548483
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16325578
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7808419
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	24613828
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	24613828
GO:0031982	Component	Vesicle	IEA
GO:0032590	Component	Dendrite membrane	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IBA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IMP	9548483
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IBA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IEA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IMP	9548483
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	24613828
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	24613828
GO:0097237	Process	Cellular response to toxic substance	IDA	24613828
GO:0097444	Component	Spine apparatus	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA

Other IDs

• MIM: 165195
• HGNC: 8153
• e!Ensembl: ENSG00000116329

Protein

• UniProt ID: P41143
• Protein name: Delta-type opioid receptor (D-OR-1) (DOR-1)
• Protein function: G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and mo
• PDB: 4N6H, 4RWA, 4RWD, 6PT2, 6PT3, 8F7S, 8Y45
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in oocytes (at protein level). Detected in brain cortex, hypothalamus, hippocampus and olfactory bulb. Detected in oocytes. {ECO:0000269|PubMed:22417668, ECO:0000269|PubMed:7808419}.
• Sequence:

  MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
  AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
  CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
  VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
  RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
  HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
  TPSDGPGGGAAA

• Sequence length: 372

Pathways

KEGG:

cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events
Interleukin-4 and Interleukin-13 signaling