Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4985
Gene name Gene Name - the full gene name approved by the HGNC.	Opioid receptor delta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OPRD1
Synonyms (NCBI Gene) Gene synonyms aliases	DOP, DOR, DOR1, OPRD
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.3

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs678849	C>G,T	Drug-response	Intron variant

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037618	hsa-miR-744-5p	CLASH	23622248
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT574284	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT574283	hsa-miR-1912	PAR-CLIP	20371350
MIRT574282	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT574281	hsa-miR-5090	PAR-CLIP	20371350
MIRT574279	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT574280	hsa-miR-184	PAR-CLIP	20371350
MIRT574278	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT1204460	hsa-miR-3909	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	IDA	22184124
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15086532, 20528919, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22184124
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7808419, 10788493
GO:0006955	Process	Immune response	TAS	9548483
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	16325578
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7808419
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0010629	Process	Negative regulation of gene expression	IDA	24613828
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IDA	24613828
GO:0031982	Component	Vesicle	IEA
GO:0032590	Component	Dendrite membrane	IEA
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IBA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IMP	9548483
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IBA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IEA
GO:0038046	Function	G protein-coupled enkephalin receptor activity	IMP	9548483
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	24613828
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	24613828
GO:0097237	Process	Cellular response to toxic substance	IDA	24613828
GO:0097444	Component	Spine apparatus	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA

MIM	HGNC	e!Ensembl
165195	8153	ENSG00000116329

Protein

UniProt ID

P41143

Protein name

Delta-type opioid receptor (D-OR-1) (DOR-1)

Protein function

G-protein coupled receptor that functions as a receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and mo

PDB

4N6H , 4RWA , 4RWD , 6PT2 , 6PT3 , 8F7S , 8Y45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	66 → 318	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in oocytes (at protein level). Detected in brain cortex, hypothalamus, hippocampus and olfactory bulb. Detected in oocytes. {ECO:0000269|PubMed:22417668, ECO:0000269|PubMed:7808419}.

Sequence

MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA

Sequence length

372

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Sphingolipid signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (i) signalling events Interleukin-4 and Interleukin-13 signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	28253273, 30152845, 33522999
Brain Diseases	Associate	23427138
Cystic Fibrosis	Associate	27572404
Cystic Fibrosis	Inhibit	35467369
Gout	Associate	35908776
Hepatitis Autoimmune	Associate	18753988
Hepatitis B Chronic	Associate	18753988
Hepatitis C Chronic	Associate	18753988
Mental Disorders	Associate	34407719
Neurodegenerative Diseases	Associate	23427138
Opioid Related Disorders	Associate	34407719
Pain	Associate	38118075
Persistent Infection	Associate	35467369
Rhinitis Atrophic	Associate	35299869
Substance Related Disorders	Associate	23427138, 34407719, 38118075

OPRD1 (opioid receptor delta 1)