Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4953
Gene name	Ornithine decarboxylase 1
Gene symbol	ODC1
Synonyms (NCBI Gene)	BABSNEDBANEDBIAODC
Chromosome	2
Chromosome location	2p25.1
Summary	This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to o

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004127	hsa-miR-192-5p	Microarray	16822819
MIRT051317	hsa-miR-15a-5p	CLASH	23622248
MIRT048600	hsa-miR-100-5p	CLASH	23622248
MIRT042942	hsa-miR-324-3p	CLASH	23622248
MIRT041549	hsa-miR-193b-3p	CLASH	23622248
MIRT440066	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440066	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT756450	hsa-miR-378a-3p	Luciferase reporter assayWestern blottingqRT-PCR	36457036
MIRT1202089	hsa-miR-105	CLIP-seq
MIRT1202090	hsa-miR-1273	CLIP-seq
MIRT1202091	hsa-miR-1283	CLIP-seq
MIRT1202092	hsa-miR-1323	CLIP-seq
MIRT1202093	hsa-miR-135a	CLIP-seq
MIRT1202094	hsa-miR-135b	CLIP-seq
MIRT1202095	hsa-miR-187	CLIP-seq
MIRT1202096	hsa-miR-188-5p	CLIP-seq
MIRT1202097	hsa-miR-214	CLIP-seq
MIRT1202098	hsa-miR-2681	CLIP-seq
MIRT1202099	hsa-miR-3163	CLIP-seq
MIRT1202100	hsa-miR-3184	CLIP-seq
MIRT1202101	hsa-miR-3617	CLIP-seq
MIRT1202102	hsa-miR-3619-5p	CLIP-seq
MIRT1202103	hsa-miR-3671	CLIP-seq
MIRT1202104	hsa-miR-423-5p	CLIP-seq
MIRT1202105	hsa-miR-4272	CLIP-seq
MIRT1202106	hsa-miR-4274	CLIP-seq
MIRT1202107	hsa-miR-4281	CLIP-seq
MIRT1202108	hsa-miR-4291	CLIP-seq
MIRT1202109	hsa-miR-4519	CLIP-seq
MIRT1202110	hsa-miR-4666-5p	CLIP-seq
MIRT1202111	hsa-miR-4668-3p	CLIP-seq
MIRT1202112	hsa-miR-4688	CLIP-seq
MIRT1202113	hsa-miR-4709-3p	CLIP-seq
MIRT1202114	hsa-miR-4711-5p	CLIP-seq
MIRT1202115	hsa-miR-4802-3p	CLIP-seq
MIRT1202116	hsa-miR-520d-5p	CLIP-seq
MIRT1202117	hsa-miR-524-5p	CLIP-seq
MIRT1202118	hsa-miR-526b	CLIP-seq
MIRT1202119	hsa-miR-548ac	CLIP-seq
MIRT1202120	hsa-miR-548ae	CLIP-seq
MIRT1202121	hsa-miR-548aj	CLIP-seq
MIRT1202122	hsa-miR-548am	CLIP-seq
MIRT1202123	hsa-miR-548c-3p	CLIP-seq
MIRT1202124	hsa-miR-548d-3p	CLIP-seq
MIRT1202125	hsa-miR-548o	CLIP-seq
MIRT1202126	hsa-miR-548x	CLIP-seq
MIRT1202127	hsa-miR-548z	CLIP-seq
MIRT1202128	hsa-miR-587	CLIP-seq
MIRT1202129	hsa-miR-600	CLIP-seq
MIRT1202130	hsa-miR-604	CLIP-seq
MIRT1202131	hsa-miR-605	CLIP-seq
MIRT1202132	hsa-miR-607	CLIP-seq
MIRT1202133	hsa-miR-641	CLIP-seq
MIRT1202134	hsa-miR-646	CLIP-seq
MIRT1202135	hsa-miR-647	CLIP-seq
MIRT1202136	hsa-miR-761	CLIP-seq
MIRT1202137	hsa-miR-922	CLIP-seq
MIRT1202089	hsa-miR-105	CLIP-seq
MIRT1202095	hsa-miR-187	CLIP-seq
MIRT1202097	hsa-miR-214	CLIP-seq
MIRT1202100	hsa-miR-3184	CLIP-seq
MIRT1202102	hsa-miR-3619-5p	CLIP-seq
MIRT1202104	hsa-miR-423-5p	CLIP-seq
MIRT1202107	hsa-miR-4281	CLIP-seq
MIRT1202108	hsa-miR-4291	CLIP-seq
MIRT1202110	hsa-miR-4666-5p	CLIP-seq
MIRT1202112	hsa-miR-4688	CLIP-seq
MIRT1202113	hsa-miR-4709-3p	CLIP-seq
MIRT1202115	hsa-miR-4802-3p	CLIP-seq
MIRT1202118	hsa-miR-526b	CLIP-seq
MIRT1202128	hsa-miR-587	CLIP-seq
MIRT1202134	hsa-miR-646	CLIP-seq
MIRT1202136	hsa-miR-761	CLIP-seq
MIRT1202137	hsa-miR-922	CLIP-seq
MIRT1202089	hsa-miR-105	CLIP-seq
MIRT1202091	hsa-miR-1283	CLIP-seq
MIRT2286687	hsa-miR-3136-3p	CLIP-seq
MIRT2286688	hsa-miR-3140-3p	CLIP-seq
MIRT2286689	hsa-miR-328	CLIP-seq
MIRT2286690	hsa-miR-3914	CLIP-seq
MIRT1202110	hsa-miR-4666-5p	CLIP-seq
MIRT1202115	hsa-miR-4802-3p	CLIP-seq
MIRT1202119	hsa-miR-548ac	CLIP-seq
MIRT1202120	hsa-miR-548ae	CLIP-seq
MIRT1202121	hsa-miR-548aj	CLIP-seq
MIRT1202122	hsa-miR-548am	CLIP-seq
MIRT1202124	hsa-miR-548d-3p	CLIP-seq
MIRT1202126	hsa-miR-548x	CLIP-seq
MIRT1202127	hsa-miR-548z	CLIP-seq
MIRT1202128	hsa-miR-587	CLIP-seq

Show/Hide all (12)

Transcription factor	Regulation	Reference
APC	Repression	12112318
CREB1	Unknown	1356108
KLF4	Repression	12297499
MAX	Activation	8262968
MLX	Unknown	19960435
MXD1	Unknown	19789310
MXD4	Unknown	19789310
MYC	Activation	21874531;8262968
MYC	Unknown	19789310
SP1	Unknown	10448078;8132514
WT1	Activation	8604351
ZNF148	Unknown	10448078

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004586	Function	Ornithine decarboxylase activity	IBA
GO:0004586	Function	Ornithine decarboxylase activity	IDA
GO:0004586	Function	Ornithine decarboxylase activity	IEA
GO:0004586	Function	Ornithine decarboxylase activity	ISS
GO:0004586	Function	Ornithine decarboxylase activity	TAS	2317811
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006595	Process	Polyamine metabolic process	IEA
GO:0006595	Process	Polyamine metabolic process	TAS
GO:0006596	Process	Polyamine biosynthetic process	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0016829	Function	Lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0033387	Process	Putrescine biosynthetic process from arginine, via ornithine	IBA
GO:0033387	Process	Putrescine biosynthetic process from arginine, via ornithine	IEA
GO:0033387	Process	Putrescine biosynthetic process from arginine, via ornithine	ISS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0042176	Process	Regulation of protein catabolic process	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS

MIM	HGNC	e!Ensembl
165640	8109	ENSG00000115758

P11926

Protein name

Ornithine decarboxylase (ODC) (EC 4.1.1.17)

Protein function

Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine. Polyamines are essential for cell proliferation and are implicated

PDB

1D7K , 2ON3 , 2OO0 , 4ZGY , 5BWA , 7S3F , 7S3G , 7U6P , 7U6U , 9B8M , 9B8N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00278	Orn_DAP_Arg_deC	40 → 387	Pyridoxal-dependent decarboxylase, C-terminal sheet domain	Domain
PF02784	Orn_Arg_deC_N	45 → 281	Pyridoxal-dependent decarboxylase, pyridoxal binding domain	Domain

Sequence

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV

Sequence length

461

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism Glutathione metabolism Metabolic pathways Efferocytosis		Regulation of ornithine decarboxylase (ODC) Metabolism of polyamines

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder with alopecia and brain abnormalities	Likely pathogenic; Pathogenic	rs1671795191, rs1671814748, rs1671814787, rs1671798353, rs1671794742	RCV001847213 RCV001263228 RCV001263229 RCV001263230 RCV001263232

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Likely benign	rs138359527	RCV005920600
Intellectual disability	Benign; Likely benign	rs150152038	RCV005626763
ODC1-related disorder	Benign; Likely benign; Uncertain significance	rs150152038, rs1301787958, rs1671816217, rs2528565818, rs141844180	RCV003928921 RCV003427985 RCV003397382 RCV003397397 RCV003894493
Ornithine decarboxylase 1 polymorphism	Benign	rs2302615	RCV000014817
Ovarian serous cystadenocarcinoma	Likely benign	rs138359527	RCV005920601

Show/Hide Text Mining Associations (75)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	34477286
Adenoma	Associate	12810952, 18413818, 20798393, 21930798
Adenoma	Inhibit	22648715
Adenomatous Polyposis Coli	Stimulate	2487240
Alopecia	Associate	33806076, 34282722
Alzheimer Disease	Associate	35738259
Anxiety	Associate	33806076
Atrial Fibrillation	Associate	36226239
Bipolar Disorder	Associate	31279243
Brain Diseases	Associate	33806076
Breast Neoplasms	Associate	22976807
Cap Myopathy	Associate	18974881
Carcinogenesis	Stimulate	12525265
Carcinogenesis	Associate	12810952, 32123240
Carcinoma Hepatocellular	Stimulate	23588207
Carcinoma Hepatocellular	Associate	6265908
Carcinoma Non Small Cell Lung	Associate	33037185
Carcinoma Renal Cell	Associate	24002681
Cardiovascular Diseases	Associate	20798393
Colonic Diseases	Associate	19789310
Colonic Neoplasms	Associate	10816435, 1598217
Colonic Neoplasms	Stimulate	15918191
Colorectal Neoplasms	Associate	12679917, 12810952, 15918191, 19789310, 27433286, 30138353
Colorectal Neoplasms	Stimulate	23588207
Developmental Disabilities	Associate	33806076
Epilepsy	Associate	33806076
Esophageal Squamous Cell Carcinoma	Associate	32872669
Fibrolamellar hepatocellular carcinoma	Associate	28270654
Gastrointestinal Diseases	Associate	20798393
Genetic Diseases Inborn	Stimulate	17569126
Glucosephosphate Dehydrogenase Deficiency	Associate	32630408
Hearing Disorders	Associate	20798393
Hyperammonemia	Associate	28270654
Hypersensitivity Delayed	Associate	33806076
Hypoxia Brain	Inhibit	26572277
Inflammation	Associate	27433286, 28658303
Intellectual Disability	Associate	33806076
Leprosy Tuberculoid	Associate	33806076
Leukemia Lymphocytic Chronic B Cell	Associate	1382719, 2904292
Leukemia Promyelocytic Acute	Associate	21372632
Lung Diseases	Associate	26572277
Lung Neoplasms	Associate	16761099, 3004454
Lung Neoplasms	Inhibit	17558447
Megalencephaly	Associate	33806076
Memory Disorders	Associate	35738259
Mental Disorders	Associate	33806076
Mood Disorders	Associate	33806076
Multiple Myeloma	Associate	1898373, 3109382, 3569540
Myopathy with Lactic Acidosis Hereditary	Inhibit	25593318
Myotonic Dystrophy	Inhibit	20174632
Neoplasms	Associate	11553856, 12525265, 14506228, 1598217, 16761099, 16854216, 17558447, 19789310, 19960435, 20215859, 21930798, 23440295, 23588207, 26514486, 27433286, 28423064, 31505062, 33806076 View all (3 more)
Neoplasms	Stimulate	15905964, 24002681, 2487240, 32872669
Neoplasms	Inhibit	22648715
Neuralgia	Associate	28260076
Neuroblastoma	Associate	19960435, 23440295, 24096079, 26018967, 26093909, 32786875
Neurologic Manifestations	Associate	34282722
Non Muscle Invasive Bladder Neoplasms	Associate	27626805
Ovarian Neoplasms	Associate	34638596
Precancerous Conditions	Associate	17569126
Precancerous Conditions	Stimulate	22442341
Prostatic Neoplasms	Inhibit	20215859
Prostatic Neoplasms	Associate	24386364
Retinal Dysplasia	Associate	17569126
Schizophrenia	Associate	33806076
Seizures	Associate	33806076
Small Cell Lung Carcinoma	Associate	6264474
Squamous Cell Carcinoma of Head and Neck	Associate	26514486
Stomach Diseases	Associate	17569126, 22442341
Stomach Neoplasms	Associate	17569126, 22442341, 34376808
Syndrome	Associate	34477286
Triple Negative Breast Neoplasms	Associate	32139506
Urea Cycle Disorders Inborn	Associate	28270654
Urethral Neoplasms	Associate	29472622, 32123240
Urinary Bladder Neoplasms	Associate	17228877
Urinary Bladder Overactive	Stimulate	19812367

ODC1 (ornithine decarboxylase 1)