Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	494551
Gene name	WEE2 oocyte meiosis inhibiting kinase
Gene symbol	WEE2
Synonyms (NCBI Gene)	OOMD5OZEMA5WEE1B
Chromosome	7
Chromosome location	7q34

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT644260	hsa-miR-3662	HITS-CLIP	23824327
MIRT644259	hsa-miR-590-5p	HITS-CLIP	23824327
MIRT644258	hsa-miR-3163	HITS-CLIP	23824327
MIRT644257	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT644256	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644255	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT644254	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT644253	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT644252	hsa-miR-7848-3p	HITS-CLIP	23824327
MIRT644251	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT644250	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT644260	hsa-miR-3662	HITS-CLIP	23824327
MIRT644259	hsa-miR-590-5p	HITS-CLIP	23824327
MIRT644258	hsa-miR-3163	HITS-CLIP	23824327
MIRT644257	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT644256	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644255	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT644254	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT644253	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT644252	hsa-miR-7848-3p	HITS-CLIP	23824327
MIRT644251	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT644250	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT2148417	hsa-miR-2110	CLIP-seq
MIRT2148418	hsa-miR-3120-3p	CLIP-seq
MIRT2148419	hsa-miR-4271	CLIP-seq
MIRT2148420	hsa-miR-4725-3p	CLIP-seq
MIRT2148421	hsa-miR-4729	CLIP-seq
MIRT2148422	hsa-miR-491-5p	CLIP-seq
MIRT2148423	hsa-miR-541	CLIP-seq
MIRT2148424	hsa-miR-545	CLIP-seq
MIRT2148425	hsa-miR-654-5p	CLIP-seq
MIRT2148426	hsa-miR-9	CLIP-seq
MIRT2148417	hsa-miR-2110	CLIP-seq
MIRT2148418	hsa-miR-3120-3p	CLIP-seq
MIRT2368852	hsa-miR-320e	CLIP-seq
MIRT2148419	hsa-miR-4271	CLIP-seq
MIRT2368853	hsa-miR-4646-5p	CLIP-seq
MIRT2148420	hsa-miR-4725-3p	CLIP-seq
MIRT2368854	hsa-miR-4768-5p	CLIP-seq
MIRT2148422	hsa-miR-491-5p	CLIP-seq
MIRT2148423	hsa-miR-541	CLIP-seq
MIRT2148424	hsa-miR-545	CLIP-seq
MIRT2148425	hsa-miR-654-5p	CLIP-seq
MIRT2148426	hsa-miR-9	CLIP-seq
MIRT2396979	hsa-miR-134	CLIP-seq
MIRT2396980	hsa-miR-3118	CLIP-seq
MIRT2396981	hsa-miR-3164	CLIP-seq
MIRT2368852	hsa-miR-320e	CLIP-seq
MIRT2662361	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0007143	Process	Female meiotic nuclear division	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035038	Process	Female pronucleus assembly	IEA
GO:0035038	Process	Female pronucleus assembly	ISS
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0060631	Process	Regulation of meiosis I	IBA
GO:0060631	Process	Regulation of meiosis I	IEA
GO:0060631	Process	Regulation of meiosis I	ISS
GO:0080154	Process	Regulation of fertilization	IEA
GO:1900194	Process	Negative regulation of oocyte maturation	IEA
GO:1900194	Process	Negative regulation of oocyte maturation	ISS

MIM	HGNC	e!Ensembl
614084	19684	ENSG00000214102

P0C1S8

Protein name

Wee1-like protein kinase 2 (EC 2.7.10.2) (Wee1-like protein kinase 1B) (Wee1B kinase)

Protein function

Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1/CDC2 and acts as a key regulator of meiosis during both prophase I and metaphase II (PubMed:29606300). Required to maintain meiotic arrest in oocytes during the germin

PDB

5VDK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	212 → 486	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in oocytes (at protein level) (PubMed:29606300). May also be expressed in testis (PubMed:11029659). {ECO:0000269|PubMed:11029659, ECO:0000269|PubMed:29606300}.

Sequence

MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPL
SNVHELDTSSEKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRL
VISPTGKLPSRGPKHLKLTPAPLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDL
EEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAI
KRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAA
ISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIE
EVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAAL
ARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTG
SRSTKRLVGGKSARSSSFTSGEREPLH

Sequence length

567

Interactions

View interactions

	KEGG
	Cell cycle Human immunodeficiency virus 1 infection

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Oocyte maturation defect 5	Pathogenic; Likely pathogenic	rs1554415096, rs1554416415, rs768323979, rs905047580, rs1380657460, rs754062320	RCV000656452 RCV000656453 RCV000656454 RCV001254889 RCV001254890 RCV001254891
WEE2-related disorder	Likely pathogenic	rs768323979	RCV004758715

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arteriosclerosis Obliterans	Stimulate	33174040
Carcinoma Hepatocellular	Associate	32838835
Glioblastoma	Associate	32838835, 36168628
Glioma	Associate	36747161, 37305396
Infertility	Associate	30826994, 31428887
Infertility Female	Associate	29606300, 30826994, 30827524, 31428887
Neoplasms	Stimulate	32838835
Neoplasms	Associate	36747161
Neoplasms	Inhibit	37305396
Renal Insufficiency	Associate	29606300, 30826994, 30827523, 30827524, 31428887, 33073652, 33904356, 34476630
Triple Negative Breast Neoplasms	Associate	32838835

WEE2 (WEE2 oocyte meiosis inhibiting kinase)