Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	494551
Gene name Gene Name - the full gene name approved by the HGNC.	WEE2 oocyte meiosis inhibiting kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WEE2
Synonyms (NCBI Gene) Gene synonyms aliases	OOMD5, OZEMA5, WEE1B
Disease Acronyms (UniProt) Disease acronyms from UniProt database	OZEMA5
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q34

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT644260	hsa-miR-3662	HITS-CLIP	23824327
MIRT644259	hsa-miR-590-5p	HITS-CLIP	23824327
MIRT644258	hsa-miR-3163	HITS-CLIP	23824327
MIRT644257	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT644256	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644255	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT644254	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT644253	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT644252	hsa-miR-7848-3p	HITS-CLIP	23824327
MIRT644251	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT644250	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT644260	hsa-miR-3662	HITS-CLIP	23824327
MIRT644259	hsa-miR-590-5p	HITS-CLIP	23824327
MIRT644258	hsa-miR-3163	HITS-CLIP	23824327
MIRT644257	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT644256	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644255	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT644254	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT644253	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT644252	hsa-miR-7848-3p	HITS-CLIP	23824327
MIRT644251	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT644250	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT2148417	hsa-miR-2110	CLIP-seq
MIRT2148418	hsa-miR-3120-3p	CLIP-seq
MIRT2148419	hsa-miR-4271	CLIP-seq
MIRT2148420	hsa-miR-4725-3p	CLIP-seq
MIRT2148421	hsa-miR-4729	CLIP-seq
MIRT2148422	hsa-miR-491-5p	CLIP-seq
MIRT2148423	hsa-miR-541	CLIP-seq
MIRT2148424	hsa-miR-545	CLIP-seq
MIRT2148425	hsa-miR-654-5p	CLIP-seq
MIRT2148426	hsa-miR-9	CLIP-seq
MIRT2148417	hsa-miR-2110	CLIP-seq
MIRT2148418	hsa-miR-3120-3p	CLIP-seq
MIRT2368852	hsa-miR-320e	CLIP-seq
MIRT2148419	hsa-miR-4271	CLIP-seq
MIRT2368853	hsa-miR-4646-5p	CLIP-seq
MIRT2148420	hsa-miR-4725-3p	CLIP-seq
MIRT2368854	hsa-miR-4768-5p	CLIP-seq
MIRT2148422	hsa-miR-491-5p	CLIP-seq
MIRT2148423	hsa-miR-541	CLIP-seq
MIRT2148424	hsa-miR-545	CLIP-seq
MIRT2148425	hsa-miR-654-5p	CLIP-seq
MIRT2148426	hsa-miR-9	CLIP-seq
MIRT2396979	hsa-miR-134	CLIP-seq
MIRT2396980	hsa-miR-3118	CLIP-seq
MIRT2396981	hsa-miR-3164	CLIP-seq
MIRT2368852	hsa-miR-320e	CLIP-seq
MIRT2662361	hsa-miR-513a-3p	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007093	Process	Mitotic cell cycle checkpoint	IBA	21873635
GO:0007143	Process	Female meiotic nuclear division	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0035038	Process	Female pronucleus assembly	ISS
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0060631	Process	Regulation of meiosis I	IBA	21873635
GO:0060631	Process	Regulation of meiosis I	ISS
GO:0080154	Process	Regulation of fertilization	IEA
GO:1900194	Process	Negative regulation of oocyte maturation	ISS

MIM	HGNC	e!Ensembl
614084	19684	ENSG00000214102

Protein

UniProt ID

P0C1S8

Protein name

Wee1-like protein kinase 2 (EC 2.7.10.2) (Wee1-like protein kinase 1B) (Wee1B kinase)

Protein function

Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1/CDC2 and acts as a key regulator of meiosis during both prophase I and metaphase II (PubMed:29606300). Required to maintain meiotic arrest in oocytes during the germin

PDB

5VDK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	212 → 486	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in oocytes (at protein level) (PubMed:29606300). May also be expressed in testis (PubMed:11029659). {ECO:0000269|PubMed:11029659, ECO:0000269|PubMed:29606300}.

Sequence

MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPL
SNVHELDTSSEKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRL
VISPTGKLPSRGPKHLKLTPAPLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDL
EEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAI
KRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAA
ISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIE
EVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAAL
ARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTG
SRSTKRLVGGKSARSSSFTSGEREPLH

Sequence length

567

Interactions

View interactions

	KEGG
	Cell cycle Human immunodeficiency virus 1 infection

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Female infertility	Female infertility due to oocyte meiotic arrest	rs587777362, rs763617076, rs1590594990, rs1307369466, rs1590594352
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Oocyte Maturation Defect	oocyte maturation defect 5	GenCC
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Arteriosclerosis Obliterans	Stimulate	33174040
Carcinoma Hepatocellular	Associate	32838835
Glioblastoma	Associate	32838835, 36168628
Glioma	Associate	36747161, 37305396
Infertility	Associate	30826994, 31428887
Infertility Female	Associate	29606300, 30826994, 30827524, 31428887
Neoplasms	Stimulate	32838835
Neoplasms	Associate	36747161
Neoplasms	Inhibit	37305396
Renal Insufficiency	Associate	29606300, 30826994, 30827523, 30827524, 31428887, 33073652, 33904356, 34476630
Triple Negative Breast Neoplasms	Associate	32838835

WEE2 (WEE2 oocyte meiosis inhibiting kinase)