TYMSOS (TYMS opposite strand RNA)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
494514
Gene name Gene Name - the full gene name approved by the HGNC.
TYMS opposite strand RNA
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TYMSOS
Synonyms (NCBI Gene) Gene synonyms aliases
C18orf56
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18p11.32
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC 29553 N/A
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8TAI1
Protein name TYMS opposite strand protein
Family and domains
Sequence 
MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGVCKARRTMRPL
PRRIEVRTKRGPQRPAAPERSPQPRLPPSRHPSRRGPRRHLSGCSAPACRIPTGCRCPCG
RPS
Sequence length 123
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Ischemic Stroke Ischemic Stroke GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35778520, 36227151