Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	494513
Gene name Gene Name - the full gene name approved by the HGNC.	Pejvakin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PJVK
Synonyms (NCBI Gene) Gene synonyms aliases	DFNB59
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the gasdermin family, a family which is found only in vertebrates. The encoded protein is required for the proper function of auditory pathway neurons. Defects in this gene are a cause of non-syndromic senso

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111706634	C>A,T	Pathogenic	Coding sequence variant, non coding transcript variant, synonymous variant, missense variant
rs118203988	C>T	Pathogenic	Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant, intron variant
rs118203989	C>G,T	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant, missense variant
rs200502817	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity, benign	5 prime UTR variant, non coding transcript variant, intron variant, missense variant, coding sequence variant
rs200507933	T>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
rs367688416	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, 5 prime UTR variant, stop gained
rs538027448	C>G,T	Pathogenic	Non coding transcript variant, stop gained, intron variant, 5 prime UTR variant, missense variant, coding sequence variant
rs1553601319	CT>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs1559365985	->T	Pathogenic	Coding sequence variant, intron variant, frameshift variant, 5 prime UTR variant, non coding transcript variant
rs1559366000	A>-	Pathogenic	Coding sequence variant, intron variant, frameshift variant, 5 prime UTR variant, non coding transcript variant
rs1559366084	ACCTTTTACAC>-	Pathogenic	Coding sequence variant, intron variant, frameshift variant, 5 prime UTR variant, non coding transcript variant
rs1559371613	T>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, intron variant
rs1559372512	ACA>-	Pathogenic	Coding sequence variant, non coding transcript variant, inframe deletion, 3 prime UTR variant
rs1559372640	G>-	Pathogenic	Coding sequence variant, 3 prime UTR variant, frameshift variant, downstream transcript variant, non coding transcript variant, genic downstream transcript variant

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT691249	hsa-miR-4796-3p	HITS-CLIP	23313552
MIRT691248	hsa-miR-3974	HITS-CLIP	23313552
MIRT691247	hsa-miR-624-3p	HITS-CLIP	23313552
MIRT691246	hsa-miR-3681-5p	HITS-CLIP	23313552
MIRT691245	hsa-miR-6849-5p	HITS-CLIP	23313552
MIRT691244	hsa-miR-4457	HITS-CLIP	23313552
MIRT691243	hsa-miR-125b-2-3p	HITS-CLIP	23313552
MIRT691242	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691241	hsa-miR-6089	HITS-CLIP	23313552
MIRT691240	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691239	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691238	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691237	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691236	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691235	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691234	hsa-miR-513b-5p	HITS-CLIP	23313552
MIRT691233	hsa-miR-7977	HITS-CLIP	23313552
MIRT691232	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691231	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691230	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691229	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691228	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691227	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691226	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691225	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691224	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691223	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691222	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691221	hsa-miR-3122	HITS-CLIP	23313552
MIRT691220	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691219	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691218	hsa-miR-6513-5p	HITS-CLIP	23313552

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0000302	Process	Response to reactive oxygen species	ISS
GO:0000425	Process	Pexophagy	IEA
GO:0000425	Process	Pexophagy	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	ISS
GO:0005929	Component	Cilium	IEA
GO:0007605	Process	Sensory perception of sound	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	ISS
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IEA
GO:0035253	Component	Ciliary rootlet	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	IEA
GO:0097468	Process	Programmed cell death in response to reactive oxygen species	IEA
GO:0097468	Process	Programmed cell death in response to reactive oxygen species	ISS
GO:0120044	Component	Stereocilium base	IEA
GO:0120045	Process	Stereocilium maintenance	IEA
GO:1900063	Process	Regulation of peroxisome organization	IEA
GO:1900063	Process	Regulation of peroxisome organization	ISS

MIM	HGNC	e!Ensembl
610219	29502	ENSG00000204311

Protein

UniProt ID

Q0ZLH3

Protein name

Pejvakin (Autosomal recessive deafness type 59 protein)

Protein function

Peroxisome-associated protein required to protect auditory hair cells against noise-induced damage. Acts by regulating noise-induced peroxisome proliferation in auditory hair cells and neurons, and promoting autophagic degradation of damaged per

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04598	Gasdermin	1 → 236	Gasdermin pore forming domain	Domain

Sequence

MFAAATKSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRYKFTSTPFTLKD
ILLGDREISAGISSYQLLNYEDESDVSLYGRRGNHIVNDVGINVAGSDSIAVKASFGIVT
KHEVEVSTLLKEITTRKINFDHSLIRQSRSSRKAVLCVVMESIRTTRQCSLSVHAGIRGE
AMRFHFMDEQNPKGRDKAIVFPAHTTIAFSVFELFIYLDGAFDLCVTSVSKGGFEREETA
TFALLYRLRNILFERNRRVMDVISRSQLYLDDLFSDYYDKPLSMTDISLKEGTHIRVNLL
NHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKRMK

Sequence length

352

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Deafness	Autosomal recessive nonsyndromic hearing loss 59	rs111706634, rs118203988, rs1559365985, rs367688416, rs118203989, rs1559372512, rs1559371613, rs1559372640, rs1559366000	N/A
Hearing Loss	Hearing loss, autosomal recessive	rs1559366084, rs367688416, rs1559372512, rs538027448	N/A
deafness	Deafness	rs367688416, rs538027448, rs1559366084	N/A

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Renal Cell	Inhibit	35321945
Colorectal Neoplasms	Associate	35836259
Deafness Autosomal Recessive 59	Associate	21935370
Deafness Autosomal Recessive 9	Associate	21935370
Hearing Disorders	Associate	21935370, 35052489
Hearing Loss	Associate	19888295, 21935370, 22617256, 32682410, 35052489
Hearing Loss	Stimulate	32682410
Hearing Loss Sensorineural	Associate	22617256
Nonsyndromic Deafness	Associate	22617256, 31389194
Nonsyndromic sensorineural hearing loss	Associate	35052489
Prostatic Neoplasms	Associate	37143720

PJVK (pejvakin)