FBXO47 (F-box protein 47)

Gene
Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
494188
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 47
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO47
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12|17q12
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all(271)
miRTarBase ID miRNA Experiments Reference
MIRT613840 hsa-miR-1305 HITS-CLIP 19536157
MIRT613839 hsa-miR-335-3p HITS-CLIP 19536157
MIRT639303 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT631466 hsa-miR-4661-5p HITS-CLIP 23824327
MIRT631465 hsa-miR-4722-3p HITS-CLIP 23824327
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609498 31969 ENSG00000204952
Protein
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Q5MNV8
Protein name F-box only protein 47
Protein function Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 43 → 80 F-box domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in kidney, liver and pancreas. Down-regulated in tumors. {ECO:0000269|PubMed:15723337}.
Sequence 
MASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLS
VKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNLELPDRRQDSAILEHYRSLGLL
FKRCTLLLPTKERLKYIHKILTEVSCFKFNGCAAPMQCLGLTCYGMFLQTLTAGWDELEC
HRVYNFLCELTNLCRKIQMAVCSKPGSAQKLELRIRLFCRNVLLDHWTHRSDSAFWLTRI
LKPWPMVNQARLLYIIFGPISPQDGQVVWQEMIEEPTDEFSLKGLADAIKLLYDASTKEW
TADDVISLVDELSVVPREWLLENNARLLMLSGNNICFSFMASKAVNGRTIELARLVVFLA
LVCEKELYCMDWTVKMMQKVCKVFSTPVERKNFLQNVANAFACVIMEMLQSIMSGDRDED
DRSFLNLFHLVHAQANFHKEVLYLTMNTPLST
Sequence length 452
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 37304650
Multiple System Atrophy Associate 27629089