Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4938
Gene name	2'-5'-oligoadenylate synthetase 1
Gene symbol	OAS1
Synonyms (NCBI Gene)	E18/E16IFI-4IMD100OIASOIASI
Chromosome	12
Chromosome location	12q24.13
Summary	This gene is induced by interferons and encodes a protein that synthesizes 2`,5`-oligoadenylates (2-5As). This protein activates latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Alternative splicing results i

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018171	hsa-miR-335-5p	Microarray	18185580
MIRT1200983	hsa-miR-1299	CLIP-seq
MIRT1200984	hsa-miR-3647-3p	CLIP-seq
MIRT1200985	hsa-miR-378	CLIP-seq
MIRT1200986	hsa-miR-378b	CLIP-seq
MIRT1200987	hsa-miR-378c	CLIP-seq
MIRT1200988	hsa-miR-378d	CLIP-seq
MIRT1200989	hsa-miR-378e	CLIP-seq
MIRT1200990	hsa-miR-378f	CLIP-seq
MIRT1200991	hsa-miR-378h	CLIP-seq
MIRT1200992	hsa-miR-378i	CLIP-seq
MIRT1200993	hsa-miR-422a	CLIP-seq
MIRT1200994	hsa-miR-4638-3p	CLIP-seq
MIRT1200995	hsa-miR-4764-5p	CLIP-seq
MIRT1200996	hsa-miR-4782-5p	CLIP-seq
MIRT1200997	hsa-miR-516b	CLIP-seq
MIRT2584419	hsa-miR-1271	CLIP-seq
MIRT2584420	hsa-miR-182	CLIP-seq
MIRT2584421	hsa-miR-186	CLIP-seq
MIRT2584422	hsa-miR-31	CLIP-seq
MIRT2584423	hsa-miR-3925-3p	CLIP-seq
MIRT2584424	hsa-miR-3978	CLIP-seq
MIRT2584425	hsa-miR-4267	CLIP-seq
MIRT2584426	hsa-miR-4694-3p	CLIP-seq
MIRT2584427	hsa-miR-4790-3p	CLIP-seq
MIRT2584428	hsa-miR-522	CLIP-seq
MIRT2584429	hsa-miR-668	CLIP-seq
MIRT2584430	hsa-miR-766	CLIP-seq
MIRT2584431	hsa-miR-9	CLIP-seq
MIRT2584432	hsa-miR-96	CLIP-seq
MIRT2584419	hsa-miR-1271	CLIP-seq
MIRT2584420	hsa-miR-182	CLIP-seq
MIRT2584421	hsa-miR-186	CLIP-seq
MIRT2584422	hsa-miR-31	CLIP-seq
MIRT2584423	hsa-miR-3925-3p	CLIP-seq
MIRT2584424	hsa-miR-3978	CLIP-seq
MIRT2584425	hsa-miR-4267	CLIP-seq
MIRT2584426	hsa-miR-4694-3p	CLIP-seq
MIRT2584427	hsa-miR-4790-3p	CLIP-seq
MIRT2584428	hsa-miR-522	CLIP-seq
MIRT2584429	hsa-miR-668	CLIP-seq
MIRT2584430	hsa-miR-766	CLIP-seq
MIRT2584431	hsa-miR-9	CLIP-seq
MIRT2584432	hsa-miR-96	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT3	Repression	18550668

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IBA
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IDA	2434505, 3753689, 3754863, 11682059, 12799444, 25205466, 25275129
GO:0001730	Function	2'-5'-oligoadenylate synthetase activity	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	12799444, 23319625, 25275129
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15039538, 23455924, 25416956, 25910212, 31515488, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	21142819
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	2434505
GO:0005634	Component	Nucleus	IDA	3753689
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21245038
GO:0005737	Component	Cytoplasm	IDA	3753689, 3754863, 19923450
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	25205466, 31817188
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	31817188
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IDA	2434505
GO:0006006	Process	Glucose metabolic process	IMP	23575436
GO:0009615	Process	Response to virus	IDA	18931074
GO:0009615	Process	Response to virus	IEA
GO:0016020	Component	Membrane	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	30822544
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	30822544
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IMP	30078389
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IMP	30078389
GO:0035457	Process	Cellular response to interferon-alpha	IDA	3753689
GO:0035458	Process	Cellular response to interferon-beta	IDA	2434505, 25205466
GO:0042593	Process	Glucose homeostasis	IMP	23575436
GO:0042742	Process	Defense response to bacterium	IMP	30822544
GO:0043129	Process	Surfactant homeostasis	IMP	29455859
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045071	Process	Negative regulation of viral genome replication	IDA	18931074, 19923450, 23196181
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051259	Process	Protein complex oligomerization	IDA	11682059
GO:0051607	Process	Defense response to virus	IDA	19923450, 23196181, 25275129
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	28640813
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IMP	30078389
GO:0060700	Process	Regulation of ribonuclease activity	IDA	19923450
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IBA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEP	32270034
GO:0071360	Process	Cellular response to exogenous dsRNA	IDA	25275129
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	30822544
GO:0071659	Process	Negative regulation of IP-10 production	IMP	30078389
GO:0098542	Process	Defense response to other organism	IEA
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0140374	Process	Antiviral innate immune response	IBA
GO:0140374	Process	Antiviral innate immune response	IDA	34581622
GO:0140374	Process	Antiviral innate immune response	IEP	25930096
GO:1901857	Process	Positive regulation of cellular respiration	IDA	31817188
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	IMP	30078389

MIM	HGNC	e!Ensembl
164350	8086	ENSG00000089127

P00973

Protein name

2'-5'-oligoadenylate synthase 1 ((2-5')oligo(A) synthase 1) (2-5A synthase 1) (EC 2.7.7.84) (E18/E16) (p46/p42 OAS)

Protein function

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response (PubMed:34581622). In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differenti

PDB

4IG8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01909	NTP_transf_2	37 → 140	Nucleotidyltransferase domain	Family
PF10421	OAS1_C	164 → 348		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lungs. {ECO:0000269|PubMed:34581622}.

Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Sequence length

400

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Hepatitis C Measles Influenza A Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19		Interferon gamma signaling OAS antiviral response Interferon alpha/beta signaling

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pulmonary alveolar proteinosis with hypogammaglobulinemia	Pathogenic; Likely pathogenic	rs2136295939, rs1555223390	RCV002248449 RCV004559338

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Benign; Likely benign	rs10774671, rs759355114	RCV005912918 RCV005935097
OAS1 polymorphism	Benign	rs10774671, rs1131454	RCV000015021 RCV000015022
OAS1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs10774671, rs7955146, rs143035510, rs77298087, rs1131476, rs35919998, rs1051042, rs2660, rs146339735, rs373546690, rs758411148, rs1279512958, rs1565965503, rs995952533, rs1131454 View all (4 more)	RCV003980443 RCV003921123 RCV003921090 RCV003921091 RCV003980544 RCV003921092 RCV003980571 RCV003975782 RCV003968864 RCV003963639 RCV003420600 RCV003400462 RCV003408463 RCV003394325 RCV003974825 RCV003979514 RCV003931505 RCV003946790 RCV003976683

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37919050, 39334033
Agammaglobulinemia	Associate	29455859, 34145065
Alzheimer Disease	Associate	34619763
Anemia	Associate	23133602
Arthritis Rheumatoid	Associate	34079550, 36189314
Autoimmune Diseases	Associate	37308670
Bacterial Infections	Associate	36189314
Breast Neoplasms	Associate	32560641, 35617355
Carcinoma Ductal	Associate	36765396
Carcinoma Hepatocellular	Associate	28704535
Communicable Diseases	Associate	28427244
COVID 19	Associate	16824203, 32771700, 33138195, 33604698, 34619763, 34730223, 34799557, 34823125, 34880855, 35003084, 35027740, 35082790, 35212764, 35421191, 35659055 View all (12 more)
Critical Illness	Associate	34619763
Cytokine Release Syndrome	Associate	36538032, 37075625
Depressive Disorder	Associate	31779701
Dermatitis	Associate	34145065
Diabetes Gestational	Associate	30389953
Diabetes Mellitus	Associate	28427244
Diabetes Mellitus Type 1	Associate	16014697, 19956105, 33973017
Diabetes Mellitus Type 2	Associate	28427244
Diabetic Nephropathies	Associate	36553678
Diverticulum	Associate	31089239
Endometrial Neoplasms	Stimulate	34337010
Fever	Stimulate	30909744
Fever	Associate	34145065
Fibrosis	Associate	19515215
Glioblastoma	Associate	21156036
Heart Diseases	Stimulate	37928544
Hepatitis B	Associate	29242559
Hepatitis C	Associate	21182542
Hepatitis C	Inhibit	24955730
Hepatitis C Chronic	Associate	19515215, 28704535
Hepatitis Chronic	Associate	28046052
HIV Infections	Associate	28186978, 37209263
Infections	Stimulate	17804510
Infections	Associate	19247438
Inflammation	Associate	23272139, 34619763, 37075625
Inflammatory Bowel Diseases	Associate	34145065
Liver Cirrhosis	Associate	19515215, 21182542, 28139728
Liver Diseases	Associate	28139728
Lung Neoplasms	Associate	39334033
Lupus Erythematosus Systemic	Associate	16947629, 27257790, 29257335, 33468161, 34079550, 36405750, 36765396
Lymphatic Metastasis	Stimulate	39334033
Mouth Diseases	Associate	16077073
Multiple Sclerosis	Associate	21735172
Nasopharyngeal Carcinoma	Associate	38009194
Neoplasms	Associate	30008265, 30814222, 35082790, 37919050, 37928544, 39334033
Non Muscle Invasive Bladder Neoplasms	Associate	33465047
Pancreatic Neoplasms	Associate	37928544
Personality Disorders	Associate	37075625
Prostatic Neoplasms	Associate	21638280, 23272139
Pulmonary Alveolar Proteinosis	Associate	29455859, 34145065
Renal Insufficiency	Stimulate	27191978
Renal Insufficiency Chronic	Associate	29642064
Scleroderma Systemic	Associate	33253099
Severe Acute Respiratory Syndrome	Associate	15766558, 16824203
Sjogren's Syndrome	Associate	28640813, 29242559, 36189916
Stomach Neoplasms	Associate	30134903
Syphilis	Associate	34781038
Syphilis secondary	Stimulate	34781038
Tuberculosis Pulmonary	Stimulate	35568895
Urinary Bladder Neoplasms	Associate	33048468, 33685397, 33888644, 36030212, 36162993
Virus Diseases	Associate	28640813, 37389217
West Nile Fever	Associate	21935451

OAS1 (2'-5'-oligoadenylate synthetase 1)