NVL (nuclear VCP like)

Gene

• Entrez ID: 4931
• Gene name: Nuclear VCP like
• Gene symbol: NVL
• Synonyms (NCBI Gene): NVL2
• Chromosome: 1
• Chromosome location: 1q42.11
• Summary: This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. Two encoded proteins, described as major and minor isoforms, h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029165	hsa-miR-26b-5p	Microarray	19088304
MIRT032271	hsa-let-7b-5p	Proteomics	18668040
MIRT050341	hsa-miR-25-3p	CLASH	23622248
MIRT045833	hsa-miR-138-5p	CLASH	23622248
MIRT044927	hsa-miR-186-5p	CLASH	23622248
MIRT1551918	hsa-miR-1287	CLIP-seq
MIRT1551919	hsa-miR-3135b	CLIP-seq
MIRT1551920	hsa-miR-4268	CLIP-seq
MIRT2058003	hsa-miR-4453	CLIP-seq
MIRT2058004	hsa-miR-4538	CLIP-seq
MIRT2058005	hsa-miR-4757-5p	CLIP-seq
MIRT2058003	hsa-miR-4453	CLIP-seq
MIRT2058004	hsa-miR-4538	CLIP-seq
MIRT2058005	hsa-miR-4757-5p	CLIP-seq
MIRT2286335	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000176	Component	Nuclear exosome (RNase complex)	IDA	26166824
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	15469983, 16782053, 22226966, 26166824, 28416111, 31358741, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	IMP	22226966
GO:0005524	Function	ATP binding	TAS	9286697
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16782053
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9286697
GO:0005654	Component	Nucleoplasm	IDA	15469983
GO:0005654	Component	Nucleoplasm	IEA
GO:0005697	Component	Telomerase holoenzyme complex	IDA	22226966
GO:0005730	Component	Nucleolus	IDA	26456651
GO:0005730	Component	Nucleolus	IDA	15469983, 22226966
GO:0005730	Component	Nucleolus	IEA
GO:0006364	Process	RRNA processing	IDA	29107693
GO:0016020	Component	Membrane	HDA	19946888
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0032092	Process	Positive regulation of protein binding	IDA	29107693
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	22226966
GO:0042254	Process	Ribosome biogenesis	IBA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042254	Process	Ribosome biogenesis	IMP	15469983, 16782053
GO:0042273	Process	Ribosomal large subunit biogenesis	IDA	26166824
GO:0042273	Process	Ribosomal large subunit biogenesis	IMP	26456651
GO:0044877	Function	Protein-containing complex binding	IEA
GO:1904749	Process	Regulation of protein localization to nucleolus	IDA	29107693
GO:1905323	Process	Telomerase holoenzyme complex assembly	IMP	22226966
GO:1990275	Function	Preribosome binding	IBA
GO:1990275	Function	Preribosome binding	IDA	16782053

Other IDs

• MIM: 602426
• HGNC: 8070
• e!Ensembl: ENSG00000143748

Protein

• UniProt ID: O15381
• Protein name: Nuclear valosin-containing protein-like (NVLp) (Nuclear VCP-like protein)
• Protein function: Participates in the assembly of the telomerase holoenzyme and effecting of telomerase activity via its interaction with TERT (PubMed:22226966). Involved in both early and late stages of the pre-rRNA processing pathways (PubMed:26166824). Spatiot
• PDB: 2X8A, 6RO1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16725	Nucleolin_bd	2 → 72	Nucleolin binding domain	Domain
  PF00004	AAA	301 → 434	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	456 → 505	AAA+ lid domain	Domain
  PF00004	AAA	618 → 748	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	773 → 830	AAA+ lid domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highest level of expression in heart, placenta, skeletal muscle, pancreas and retina. {ECO:0000269|PubMed:9286697}.
• Sequence:

  MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVE
  KVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMN
  SSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPS
  VKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVDG
  EIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLGVVPPRG
  VLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCI
  IFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPAL
  RRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCRE
  AAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP
  LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAP
  VRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESE
  RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFI
  MAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIA
  GDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSIS
  KKDQIMYERLQESLSR

• Sequence length: 856

Pathways

KEGG:

Ribosome biogenesis in eukaryotes