Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4929
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 4 group A member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR4A2
Synonyms (NCBI Gene) Gene synonyms aliases
HZF-3, IDLDP, NOT, NURR1, RNR1, TINUR
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parki
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1553456695 ->C Likely-pathogenic Non coding transcript variant, frameshift variant, coding sequence variant
rs1573811478 ->GTCG Likely-pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003538 hsa-miR-372-3p Luciferase reporter assay, Microarray 19885849
MIRT003538 hsa-miR-372-3p Luciferase reporter assay, Microarray 19885849
MIRT003537 hsa-miR-302d-3p Luciferase reporter assay, Microarray 19885849
MIRT003537 hsa-miR-302d-3p Luciferase reporter assay, Microarray 19885849
MIRT003537 hsa-miR-302d-3p Luciferase reporter assay, Microarray 19885849
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18463503
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 22988876
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601828 7981 ENSG00000153234
Protein
UniProt ID P43354
Protein name Nuclear receptor subfamily 4 group A member 2 (Immediate-early response protein NOT) (Orphan nuclear receptor NURR1) (Transcriptionally-inducible nuclear receptor)
Protein function Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development (PubMed:15716272, PubMed:17184956). It is crucial for expression of a set of genes such as S
PDB 1OVL , 5Y41 , 5YD6 , 6DDA , 6L6L , 6L6Q , 7WNH , 8CYO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 261 330 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 392 579 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVK
EVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLE
DLVPPPAIIDKLFLDTLPF
Sequence length 598
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Aldosterone synthesis and secretion
Parathyroid hormone synthesis, secretion and action
  Nuclear Receptor transcription pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epilepsy epilepsy rs1553456695 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
autism Autism N/A N/A ClinVar
Neurodevelopmental Disorders neurodevelopmental disorder, complex neurodevelopmental disorder N/A N/A GenCC
Parkinson disease parkinson disease, late-onset, Parkinson Disease, Dominant/Recessive N/A N/A ClinVar
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 23066323
Alzheimer Disease Inhibit 16320253
Arthritis Associate 11315917, 34248958
Arthritis Psoriatic Associate 11315917
Arthritis Rheumatoid Associate 11315917, 35508128
Arthritis Rheumatoid Stimulate 22275273
Atherosclerosis Associate 34248958
Attention Deficit Disorder with Hyperactivity Associate 22294735
Autism Spectrum Disorder Associate 27569545, 30504930
Autistic Disorder Associate 30504930