Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4922
Gene name Gene Name - the full gene name approved by the HGNC.	Neurotensin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NTS
Synonyms (NCBI Gene) Gene synonyms aliases	NMN-125, NN, NT, NT/N, NTS1
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. I

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments
MIRT1196318	hsa-miR-181a	CLIP-seq
MIRT1196319	hsa-miR-181b	CLIP-seq
MIRT1196320	hsa-miR-181c	CLIP-seq
MIRT1196321	hsa-miR-181d	CLIP-seq
MIRT1196322	hsa-miR-4262	CLIP-seq
MIRT1196323	hsa-miR-4698	CLIP-seq
MIRT1196324	hsa-miR-4704-3p	CLIP-seq
MIRT1196325	hsa-miR-543	CLIP-seq
MIRT1196326	hsa-miR-587	CLIP-seq
MIRT1196318	hsa-miR-181a	CLIP-seq
MIRT1196319	hsa-miR-181b	CLIP-seq
MIRT1196320	hsa-miR-181c	CLIP-seq
MIRT1196321	hsa-miR-181d	CLIP-seq
MIRT1196322	hsa-miR-4262	CLIP-seq
MIRT1196323	hsa-miR-4698	CLIP-seq
MIRT1196324	hsa-miR-4704-3p	CLIP-seq
MIRT1196325	hsa-miR-543	CLIP-seq
MIRT1196326	hsa-miR-587	CLIP-seq
MIRT1196318	hsa-miR-181a	CLIP-seq
MIRT1196319	hsa-miR-181b	CLIP-seq
MIRT1196320	hsa-miR-181c	CLIP-seq
MIRT1196321	hsa-miR-181d	CLIP-seq
MIRT1196322	hsa-miR-4262	CLIP-seq
MIRT1196323	hsa-miR-4698	CLIP-seq
MIRT1196324	hsa-miR-4704-3p	CLIP-seq
MIRT1196325	hsa-miR-543	CLIP-seq
MIRT1196326	hsa-miR-587	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
ATF1	Unknown	7791794
CREB1	Unknown	7791794
FOS	Unknown	7791794
JUN	Unknown	7791794
JUND	Unknown	7791794
NR2F2	Unknown	21030593

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	10969042, 11815627, 17620610, 23597562, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	NAS	8954810
GO:0007218	Process	Neuropeptide signaling pathway	IDA	11294867
GO:0007218	Process	Neuropeptide signaling pathway	IGI	21806946
GO:0010628	Process	Positive regulation of gene expression	IDA	21806946
GO:0010629	Process	Negative regulation of gene expression	IDA	21806946
GO:0030133	Component	Transport vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	12074933
GO:0043679	Component	Axon terminus	IBA
GO:0048018	Function	Receptor ligand activity	IDA	11294867
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21806946
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12074933
GO:0071855	Function	Neuropeptide receptor binding	IPI	11294867
GO:0097746	Process	Blood vessel diameter maintenance	IEA

MIM	HGNC	e!Ensembl
162650	8038	ENSG00000133636

Protein

UniProt ID

P30990

Protein name

Neurotensin/neuromedin N [Cleaved into: Large neuromedin N (NmN-125); Neuromedin N (NN) (NmN); Neurotensin (NT); Tail peptide]

Protein function

Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.

PDB

2LNE , 2LNF , 2LNG , 2LYW , 2OYV , 2OYW , 3F6K , 4PO7 , 5LUZ , 6UP7 , 8VJY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07421	Pro-NT_NN	7 → 170	Neurotensin/neuromedin N precursor	Family

Sequence

MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN
VCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE
LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

Sequence length

170

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lewy Body Disease	Lewy body disease	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	33493519
Breast Neoplasms	Associate	19156213, 21725197
Carcinogenesis	Associate	30359740, 33543354
Carcinoma Ductal Breast	Associate	19156213
Carcinoma Hepatocellular	Associate	23418512
Carcinoma in Situ	Stimulate	30883751
Carcinoma Non Small Cell Lung	Associate	31614143
Carcinoma Pancreatic Ductal	Associate	17641415
Cardiovascular Diseases	Associate	27312221
Cholangiocarcinoma	Associate	30359740
Colorectal Neoplasms	Associate	11093935, 16984735, 17000667, 20663927, 23962427, 25098665, 28498396, 32764278, 8651737
Gastrointestinal Neoplasms	Associate	17000667, 25098665
Glioma	Associate	31104065
Inflammation	Associate	11574537, 21212273, 23418512
Insulin Resistance	Associate	37047432
Leukemia B Cell	Associate	23109725
Leukemia Lymphocytic Chronic B Cell	Associate	23109725, 29059151
Lung Neoplasms	Associate	31614143, 33493519
Neoplasm Metastasis	Stimulate	30359740
Neoplasms	Stimulate	17000667
Neoplasms	Associate	18048355, 19156213, 23418512, 28498396, 30359740, 30959962, 32764278, 33543354, 8651737
Neoplasms Adipose Tissue	Associate	29690638
Neuroendocrine Tumors	Associate	25098665, 26298774
Obesity	Associate	29690638, 33543354, 37047432
Ovarian Neoplasms	Associate	30883751
Overweight	Associate	37047432
Pancreatic Neoplasms	Associate	17641415, 19393580, 8387763
Parkinson Disease	Associate	36516809
Prostate cancer familial	Associate	25724188
Prostatic Neoplasms	Associate	8197117
Stomach Neoplasms	Associate	25724188

NTS (neurotensin)