NTRK3 (neurotrophic receptor tyrosine kinase 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 4916
Gene name Neurotrophic receptor tyrosine kinase 3
Gene symbol NTRK3
Synonyms (NCBI Gene)
GP145-TrkCTRKCgp145(trkC)
Chromosome 15
Chromosome location 15q25.3
Summary This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to
miRNA miRNA information provided by mirtarbase database.
106
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (106)
miRTarBase ID miRNA Experiments Reference
MIRT003754 hsa-miR-125b-5p Western blotReporter assay 17483472
MIRT003323 hsa-miR-9-5p Luciferase reporter assayWestern blot 17483472
MIRT003755 hsa-miR-125a-5p Luciferase reporter assayWestern blot 17483472
MIRT003754 hsa-miR-125b-5p Luciferase reporter assayWestern blot 17483472
MIRT003755 hsa-miR-125a-5p Luciferase reporter assay 19179615
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
SOX2 Activation 22265740
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
69
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (69)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001764 Process Neuron migration IEA
GO:0002039 Function P53 binding IPI 23027130
GO:0004672 Function Protein kinase activity IEA
GO:0004713 Function Protein tyrosine kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
191316 8033 ENSG00000140538
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16288
Protein name NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)
Protein function Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/
PDB 1WWC , 3V5Q , 4YMJ , 6KZC , 6KZD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 31 → 58 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 103 → 162 Leucine rich repeat Repeat
PF16920 TPKR_C2 163 → 208 Tyrosine-protein kinase receptor C2 Ig-like domain Domain
PF00047 ig 214 → 299 Immunoglobulin domain Domain
PF07679 I-set 316 → 392 Immunoglobulin I-set domain Domain
PF07714 PK_Tyr_Ser-Thr 538 → 824 Protein tyrosine and serine/threonine kinase Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed but mainly in nervous tissue. Isoform 2 is expressed at higher levels in adult brain than in fetal brain.
Sequence 
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Sequence length 839
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Calcium signaling pathway
Neurotrophin signaling pathway
Central carbon metabolism in cancer 		  Receptor-type tyrosine-protein phosphatases
NTF3 activates NTRK3 signaling
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through PI3K
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
28
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (11)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cabozantinib resistance other rs2141954132 RCV001824998
Entrectinib resistance other rs2141954132 RCV001824997
RCV001824998
Larotrectinib resistance other rs2141954132 RCV001824998
Malignant tumor of esophagus Benign rs16941321 RCV005919764
Show/Hide Text Mining Associations (113)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 12121325
Adenocarcinoma Associate 27282352
Adenocarcinoma of Lung Associate 27151654, 38376315
Adenoma Associate 33046021
Alcoholism Associate 27826991
Alzheimer Disease Inhibit 16539663, 28888073
Astrocytoma Associate 17971243
Autism Spectrum Disorder Associate 23715297
Autistic Disorder Associate 23715297
Bipolar Disorder Associate 23727532