NTRK3 (neurotrophic receptor tyrosine kinase 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4916
Gene name Gene Name - the full gene name approved by the HGNC.
Neurotrophic receptor tyrosine kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NTRK3
Synonyms (NCBI Gene) Gene synonyms aliases
GP145-TrkC, TRKC, gp145(trkC)
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(106)
miRTarBase ID miRNA Experiments Reference
MIRT003754 hsa-miR-125b-5p Western blot, Reporter assay 17483472
MIRT003323 hsa-miR-9-5p Luciferase reporter assay, Western blot 17483472
MIRT003755 hsa-miR-125a-5p Luciferase reporter assay, Western blot 17483472
MIRT003754 hsa-miR-125b-5p Luciferase reporter assay, Western blot 17483472
MIRT003755 hsa-miR-125a-5p Luciferase reporter assay 19179615
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SOX2 Activation 22265740
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(69)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001764 Process Neuron migration IEA
GO:0002039 Function P53 binding IPI 23027130
GO:0004672 Function Protein kinase activity IEA
GO:0004713 Function Protein tyrosine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
191316 8033 ENSG00000140538
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q16288
Protein name NT-3 growth factor receptor (EC 2.7.10.1) (GP145-TrkC) (Trk-C) (Neurotrophic tyrosine kinase receptor type 3) (TrkC tyrosine kinase)
Protein function Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/
PDB 1WWC , 3V5Q , 4YMJ , 6KZC , 6KZD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 31 → 58 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 103 → 162 Leucine rich repeat Repeat
PF16920 TPKR_C2 163 → 208 Tyrosine-protein kinase receptor C2 Ig-like domain Domain
PF00047 ig 214 → 299 Immunoglobulin domain Domain
PF07679 I-set 316 → 392 Immunoglobulin I-set domain Domain
PF07714 PK_Tyr_Ser-Thr 538 → 824 Protein tyrosine and serine/threonine kinase Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed but mainly in nervous tissue. Isoform 2 is expressed at higher levels in adult brain than in fetal brain.
Sequence 
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Sequence length 839
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Calcium signaling pathway
Neurotrophin signaling pathway
Central carbon metabolism in cancer 		  Receptor-type tyrosine-protein phosphatases
NTF3 activates NTRK3 signaling
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through PI3K
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital Heart Disease congenital heart disease N/A N/A GenCC
Dementia Dementia N/A N/A GWAS
Diabetes Diabetic peripheral neuropathy in type 2 diabetes N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Show/Hide Text Mining Associations (113)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 12121325
Adenocarcinoma Associate 27282352
Adenocarcinoma of Lung Associate 27151654, 38376315
Adenoma Associate 33046021
Alcoholism Associate 27826991
Alzheimer Disease Inhibit 16539663, 28888073
Astrocytoma Associate 17971243
Autism Spectrum Disorder Associate 23715297
Autistic Disorder Associate 23715297
Bipolar Disorder Associate 23727532