Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4914
Gene name Gene Name - the full gene name approved by the HGNC.	Neurotrophic receptor tyrosine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NTRK1
Synonyms (NCBI Gene) Gene synonyms aliases	MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to ce

Show/Hide all(43)

SNP ID	Visualize variation	Clinical significance	Consequence
rs6336	C>T	Benign, benign-likely-benign, pathogenic	Coding sequence variant, missense variant
rs6339	G>T	Benign, benign-likely-benign, pathogenic	Coding sequence variant, missense variant
rs35669708	G>A,C	Benign-likely-benign, benign, pathogenic, likely-benign	Coding sequence variant, missense variant
rs80356674	T>A	Pathogenic	Intron variant
rs80356675	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs80356676	->T	Pathogenic	Frameshift variant, coding sequence variant
rs80356677	G>T	Pathogenic	Missense variant, coding sequence variant
rs121964866	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs121964868	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs121964869	A>G	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs121964870	A>G	Pathogenic	Missense variant, coding sequence variant
rs137979116	C>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs137994522	C>G,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs201503610	T>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs370483210	G>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs398122810	TG>-	Pathogenic	Coding sequence variant, frameshift variant, intron variant
rs543320028	C>A,T	Uncertain-significance, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs606231466	A>T	Pathogenic	Intron variant
rs606231467	G>A	Pathogenic	Coding sequence variant, missense variant
rs747711259	T>C	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs747976486	G>A,C	Pathogenic	Stop gained, coding sequence variant, missense variant
rs756981419	C>T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs759637817	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs763758904	C>A,T	Pathogenic, uncertain-significance	Stop gained, synonymous variant, coding sequence variant
rs764171953	G>A	Likely-pathogenic	Splice acceptor variant
rs786205449	G>A,T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs797045059	A>C	Pathogenic	Splice acceptor variant
rs797045060	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant
rs879253889	C>T	Pathogenic	Coding sequence variant, stop gained
rs879253890	A>T	Pathogenic	Coding sequence variant, stop gained
rs914061514	A>C	Likely-pathogenic	Intron variant
rs1026300967	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1064793219	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1363364803	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs1452844753	G>T	Likely-pathogenic	Splice donor variant
rs1485714154	G>-	Uncertain-significance, pathogenic	Frameshift variant, coding sequence variant
rs1553263326	G>A	Likely-pathogenic	Intron variant
rs1558104865	CAG>-	Likely-pathogenic	Splice acceptor variant, intron variant
rs1558105252	->TTGT	Pathogenic	Coding sequence variant, frameshift variant
rs1571685736	TCGCCTGTG>-	Uncertain-significance, likely-pathogenic	Splice donor variant, coding sequence variant, intron variant
rs1571689751	C>T	Pathogenic	Coding sequence variant, stop gained
rs1571690112	G>-	Pathogenic	Coding sequence variant, splice acceptor variant
rs1571696060	GGTGTCTGCGCCT>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2056950	hsa-miR-873	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ING4	Repression	22078444
MYCN	Repression	21123453

Show/Hide all(128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	2927393
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IDA	15488758, 27655914
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IMP	1281417
GO:0005004	Function	GPI-linked ephrin receptor activity	IEA
GO:0005030	Function	Neurotrophin receptor activity	IBA
GO:0005030	Function	Neurotrophin receptor activity	IEA
GO:0005166	Function	Neurotrophin p75 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	8226808, 8384556, 10490030, 12237455, 14985763, 15488758, 17389358, 21102451, 21364532, 21570973, 22939624, 26446845, 27445338, 28197073, 35384245
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1281417, 2927393, 15488758, 27655914
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IDA	15488758
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15488758
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15488758
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010465	Function	Nerve growth factor receptor activity	IDA	15488758
GO:0010465	Function	Nerve growth factor receptor activity	IMP	1281417
GO:0010623	Process	Programmed cell death involved in cell development	IEA
GO:0010623	Process	Programmed cell death involved in cell development	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IDA	15488758
GO:0010976	Process	Positive regulation of neuron projection development	IDA	15488758
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	2927393
GO:0019900	Function	Kinase binding	IEA
GO:0021553	Process	Olfactory nerve development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031175	Process	Neuron projection development	IDA	27655914
GO:0031175	Process	Neuron projection development	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	ISS
GO:0035094	Process	Response to nicotine	IEA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	27655914
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IMP	1281417
GO:0038180	Process	Nerve growth factor signaling pathway	IBA
GO:0038180	Process	Nerve growth factor signaling pathway	IEA
GO:0038180	Process	Nerve growth factor signaling pathway	IEA
GO:0038180	Process	Nerve growth factor signaling pathway	IMP	1281417
GO:0042490	Process	Mechanoreceptor differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	21187090, 28197073
GO:0042803	Function	Protein homodimerization activity	IDA	1281417, 17196528
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	22635104
GO:0043068	Process	Positive regulation of programmed cell death	IEA
GO:0043068	Process	Positive regulation of programmed cell death	ISS
GO:0043121	Function	Neurotrophin binding	IBA
GO:0043121	Function	Neurotrophin binding	TAS	9290260
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043547	Process	Positive regulation of GTPase activity	IDA	15488758
GO:0043547	Process	Positive regulation of GTPase activity	IDA	15488758
GO:0045766	Process	Positive regulation of angiogenesis	IDA	15488758
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IDA	15488758
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IDA	15488758
GO:0046777	Process	Protein autophosphorylation	IDA	15488758
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IDA	15488758
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048406	Function	Nerve growth factor binding	IDA	15488758
GO:0048406	Function	Nerve growth factor binding	IDA	1281417, 15488758, 17196528
GO:0048406	Function	Nerve growth factor binding	IEA
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048485	Process	Sympathetic nervous system development	ISS
GO:0048666	Process	Neuron development	IDA	27655914
GO:0048678	Process	Response to axon injury	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15488758
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051599	Process	Response to hydrostatic pressure	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS	19036963
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0055037	Component	Recycling endosome	IEA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0060009	Process	Sertoli cell development	IEA
GO:0060384	Process	Innervation	IEA
GO:0060385	Process	Axonogenesis involved in innervation	IEA
GO:0060385	Process	Axonogenesis involved in innervation	ISS
GO:0061368	Process	Behavioral response to formalin induced pain	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15488758
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15488758
GO:0071316	Process	Cellular response to nicotine	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11927634
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IBA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IMP	1281417
GO:1990090	Process	Cellular response to nerve growth factor stimulus	ISS

MIM	HGNC	e!Ensembl
191315	8031	ENSG00000198400

Protein

UniProt ID

P04629

Protein name

High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1-transforming tyrosine kinase protein) (Tropomyosin-related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk-A) (gp140trk) (

Protein function

Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor fo

PDB

1HE7 , 1SHC , 1WWA , 1WWW , 2IFG , 2N90 , 4AOJ , 4CRP , 4F0I , 4GT5 , 4PMM , 4PMP , 4PMS , 4PMT , 4YNE , 4YPS , 5H3Q , 5I8A , 5JFS , 5JFV , 5JFW , 5JFX , 5KMI , 5KMJ , 5KMK , 5KML , 5KMM , 5KMN , 5KMO , 5KVT , 5WR7 , 6D1Y , 6D1Z , 6D20 , 6D22 , 6DKB , 6DKG , 6DKI , 6DKW , 6IQN , 6J5L , 6NPT , 6NSP , 6NSS , 6PL1 , 6PL2 , 6PL3 , 6PL4 , 6PMA , 6PMB , 6PMC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16920	TPKR_C2	151 → 192	Tyrosine-protein kinase receptor C2 Ig-like domain	Domain
PF18613	TrkA_TMD	417 → 438	Tyrosine kinase receptor A trans-membrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	510 → 781	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform TrkA-I is found in most non-neuronal tissues. Isoform TrkA-II is primarily expressed in neuronal cells. TrkA-III is specifically expressed by pluripotent neural stem and neural crest progenitors. {ECO:0000269|PubMed:15488758, E

Sequence

MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG

Sequence length

796

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Apoptosis Neurotrophin signaling pathway Inflammatory mediator regulation of TRP channels Pathways in cancer Transcriptional misregulation in cancer Thyroid cancer Central carbon metabolism in cancer		Frs2-mediated activation ARMS-mediated activation Retrograde neurotrophin signalling TRKA activation by NGF PI3K/AKT activation

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	rs748672380, rs747711259, rs1571695851, rs1232901259, rs764992664, rs756981419, rs764816792, rs763758904, rs1571685736, rs1485714154	N/A
hereditary insensitivity to pain with anhidrosis	Hereditary insensitivity to pain with anhidrosis	rs1647277529, rs747711259, rs1485714154, rs80356674, rs369353892, rs748672380, rs398122810, rs1648159596, rs764171953, rs1571695851, rs606231466, rs780724170, rs370483210, rs914061514, rs1232901259 View all (30 more)	N/A

Show/Hide Unknown Diseases (8)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
hereditary cancer	Hereditary cancer	N/A	N/A	ClinVar
hereditary sensory and autonomic neuropathy	Hereditary sensory and autonomic neuropathy	N/A	N/A	ClinVar
Hereditary Sensory And Autonomic Neuropathy	hereditary sensory and autonomic neuropathy type 4	N/A	N/A	GenCC
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Medullary thyroid carcinoma	familial medullary thyroid carcinoma	N/A	N/A	ClinVar, GenCC
Parkinson disease	Parkinson disease	N/A	N/A	GWAS
premature ovarian failure	Premature ovarian failure	N/A	N/A	ClinVar
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (204)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	36499693
Acute cholinergic dysautonomia	Inhibit	33536237
Acute erythroleukemia	Associate	19059881
Adenocarcinoma	Associate	33768710
Adenocarcinoma of Lung	Associate	27151654, 30115026, 33768710, 33865348, 34362997
Adenoma Pleomorphic	Associate	33727696
Adrenal Gland Diseases	Associate	38241559
Alzheimer Disease	Inhibit	10693951, 16539663, 20561151, 21397006
Alzheimer Disease	Associate	23095849
Amyotrophic Lateral Sclerosis	Associate	31575382
Anemia Diamond Blackfan	Associate	30926971
Anodontia	Associate	31871300
Arthritis	Associate	19490633
Arthritis Psoriatic	Stimulate	21792838
Arthritis Rheumatoid	Stimulate	21792838
Arthritis Rheumatoid	Associate	7559588
Askin Tumor	Inhibit	11850535
Asthma	Associate	23195334
Astrocytoma	Associate	17635673, 17971243
Astrocytoma	Stimulate	37951450
Atrial Fibrillation	Associate	32781864
Atrophy	Associate	38241559
Bloom Syndrome	Associate	33219493
Bohring syndrome	Associate	27259011
Bone Diseases Metabolic	Associate	30461622
Brain Neoplasms	Associate	25970776, 27503856
Breast Neoplasms	Associate	10681513, 11359788, 17617666, 18716795, 23948750, 28590426, 31575382, 31823098, 32348852, 32957504, 36034422, 36140725
Breast Neoplasms Male	Associate	36614261, 38369186
Calcinosis Cutis	Associate	26563355, 29683819, 32348852
Carcinogenesis	Associate	10646882, 30134855, 31823098, 38531265
Carcinoma	Associate	30134855, 32669612, 32957984, 35149769, 35900506, 36229858
Carcinoma Ductal	Stimulate	32957504
Carcinoma Merkel Cell	Associate	28793172, 31640749, 36499693
Carcinoma Non Small Cell Lung	Associate	26565381, 30914778, 32329651, 34599262, 35289703, 36256645, 37714814, 40247220
Carcinoma Ovarian Epithelial	Associate	33081171
Carcinoma Pancreatic Ductal	Associate	31605106
Carcinoma Papillary	Associate	10646882, 1381340
Carcinoma Renal Cell	Associate	31208361
Carcinoma Squamous Cell	Associate	21466358, 30360033
Carcinoma Squamous Cell	Stimulate	29802376
Central Nervous System Neoplasms	Associate	34850167
Cerebral Hemorrhage	Associate	21672317
Charcot Marie Tooth disease Type 1C	Associate	38098081
Cholangiocarcinoma	Associate	24563076, 24744599
Cleft Lip	Associate	30411541
Cleft Palate	Associate	30411541
Cognition Disorders	Associate	16539663
Cognition Disorders	Inhibit	23095849
Cognitive Dysfunction	Associate	16539663
Cognitive Dysfunction	Inhibit	21397006, 23095849
Colitis Ulcerative	Associate	10764711
Colonic Neoplasms	Associate	33707574
Colorectal Neoplasms	Associate	25926053, 26472021, 26563355, 28591715, 29045518, 31871300, 32627883, 33707574, 35008821, 35237889, 35506567, 35584350, 36416133, 36700211, 37142453, 37686416, 9290260 View all (2 more)
Craniopharyngioma	Associate	35707464
Crohn Disease	Associate	10764711
Death	Associate	15386308
Dementia	Associate	35327643
Demyelinating Diseases	Associate	38241559
Developmental Defects of Enamel	Associate	8696348
Disease	Associate	39355617
Down Syndrome	Inhibit	10693951
Down Syndrome	Associate	28590426
Drug Hypersensitivity	Associate	25389033, 29054434
Endometrial Neoplasms	Associate	37686416
Endometrial Stromal Tumors	Associate	33077922
Endometriosis	Associate	25865020, 37164275
Endometriosis	Stimulate	37405438
Epilepsy Familial Mesial Temporal Lobe	Associate	25027171
Erdheim Chester Disease	Associate	27617936
Esophageal Neoplasms	Associate	32323889
Esophageal Squamous Cell Carcinoma	Associate	16832412
Essential Tremor	Associate	31404076
Fever	Associate	10233776, 30461622, 38241559
Fever of Unknown Origin	Associate	37922692
Fibrocartilaginous embolism	Associate	16539663
Fibrosarcoma	Associate	27093299, 30709876, 31738425, 33219493, 33850302, 34120511, 36997313
Foot Deformities	Associate	30461622
Fractures Spontaneous	Associate	10646882
Gallbladder Neoplasms	Stimulate	20353905
Ganglioneuroma	Associate	9099963
Gastrointestinal Neoplasms	Associate	40068370
Gastrointestinal Stromal Tumors	Associate	32669612, 36357104, 38191907
Genetic Diseases Inborn	Associate	10233776, 11071380, 29054434, 33077922
Giant Cell Tumor of Tendon Sheath	Associate	33727696
Glaucoma	Associate	34646884
Glioblastoma	Associate	17635673, 37951450
Glioma	Associate	30171197, 32238360, 32665022, 33749791, 34257579, 37349135, 37503880
Granuloma	Associate	21059230
Heart Diseases	Associate	28888073
Heart Valve Diseases	Associate	32781864
Hereditary leiomyomatosis and renal cell cancer	Associate	15677564
Hereditary Sensory and Autonomic Neuropathies	Associate	10330344, 10982191, 11071380, 19651702, 21708027, 22302274, 23799134, 25984678, 27265460, 27676246, 28345382, 29054434, 29770739, 30461622, 32807182 View all (8 more)
Histiocytosis Langerhans Cell	Associate	27617936
Histiocytosis Non Langerhans Cell	Associate	27617936
Hodgkin Disease	Associate	15677564
Hyperalgesia	Associate	10084541
Hyperalgesia	Stimulate	35925599
Hypersensitivity Immediate	Associate	33004339
Hypohidrosis	Associate	10233776, 19651702, 34732685, 37248554
Ige Responsiveness Atopic	Associate	30584054
Inflammation	Associate	25389033, 33971977
Inflammatory Bowel Diseases	Associate	10764711
Intellectual Disability	Associate	10233776
Intestinal Neoplasms	Associate	36357104
Ischemia	Associate	15579199
Keratoconus	Associate	16275928
Laryngeal Neoplasms	Associate	28269752
Leiomyosarcoma	Associate	29553955
Leukemia	Stimulate	19059881
Leukemia	Associate	30926971, 31905241, 9949179
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	33456567
Leukemia Myeloid Acute	Associate	15731354, 18270328, 30926971
Leydig Cell Tumor	Associate	32074942
Liposarcoma	Associate	38531265
Liver Diseases	Associate	31605106
Lung Diseases	Associate	26216294, 26565381, 35149769
Lung Neoplasms	Associate	21466358, 24162815, 28183697, 30115026, 30972901, 32329651, 33168793, 33963267, 34791810, 35085007
Lymphatic Metastasis	Associate	29037860
Lymphoma	Associate	19797732
Lymphoma Large B Cell Diffuse	Associate	22076137
Lymphoma Non Hodgkin	Associate	34850167
Malformations of Cortical Development	Associate	12121325
Malignant mesenchymal tumor	Associate	32669612, 32889887, 32957984, 33850302, 33986460, 35149769
Mast Cell Activation Disorders	Associate	10764711
Mastocytoma	Associate	21501463
Mastocytosis	Associate	23869086
Medulloblastoma	Associate	19943845, 27503856, 9420431
Melanoma	Associate	18305571, 21418516, 26496938, 29683819, 31900433, 35457078, 38195702
Melanoma Cutaneous Malignant	Associate	36672171
Mental Disorders	Associate	22986407
Microsatellite Instability	Associate	31871300, 32627883, 35584350
Motor Neuron Disease	Associate	20561151
Mouth Neoplasms	Associate	35925599
Multiple Myeloma	Associate	27246973
Multiple Pulmonary Nodules	Associate	29610391
Multiple Trauma	Associate	27246973
Myasthenia Gravis	Associate	15763921
Myotonic Dystrophy	Associate	36767649
Neoplasm Metastasis	Associate	26563355, 30134855, 32187423, 32323889, 32749467, 32957504, 34237031, 35363931, 35925599
Neoplasm Metastasis	Inhibit	35457078
Neoplasms	Associate	1381340, 15386308, 15654083, 17971243, 19755097, 19797732, 19943845, 21134548, 21552290, 21990266, 22385957, 22992069, 24067459, 24162815, 24445538 View all (93 more)
Neoplasms	Inhibit	17635673, 19734938, 35167738, 36140725, 37461056
Neoplasms Germ Cell and Embryonal	Associate	15654083
Neoplastic Syndromes Hereditary	Associate	31404076
Nerve Degeneration	Associate	8441429
Neuroblastoma	Associate	10550322, 15386308, 15654083, 15802787, 15961390, 17409494, 18057715, 19016768, 19734938, 20003389, 21109931, 21419569, 21990266, 23047593, 23319303 View all (22 more)
Neurodegenerative Diseases	Associate	33536237, 37984302
Neurofibrosarcoma	Associate	33707600
Neurologic Manifestations	Associate	37070091
Neuropathy Painful	Associate	23666525
Nevus	Associate	35457078
Nevus Epithelioid and Spindle Cell	Associate	34830218, 37856952
Non Muscle Invasive Bladder Neoplasms	Associate	28344356
Osteoarthritis	Stimulate	30562625, 34494934
Osteosarcoma	Associate	24067459
Ovarian Neoplasms	Associate	19263582, 23746174, 27875625, 38200576
Pain	Associate	10561084, 29054434, 35925599, 37070091
Pain Insensitivity Congenital	Associate	10233776, 19651702, 30461622, 34674383, 34732685, 37248554
Paine syndrome	Associate	10561084
Pancreatic Neoplasms	Associate	27792755, 33755158
Pancreatic Neoplasms	Stimulate	32294802
Pancreaticobiliary Maljunction	Associate	39341739
Pancreatitis Chronic	Stimulate	10561084
Papillomavirus Infections	Associate	37461056
Paraneoplastic Syndromes Ocular	Associate	34075771
Parotid Neoplasms	Associate	36266462
Peripheral Nerve Injuries	Associate	9669765
Peripheral Nervous System Diseases	Associate	35405097
Peripheral Nervous System Neoplasms	Associate	15386308
Pneumonia	Associate	33971977
Porphyria Acute Intermittent	Associate	30134855
Prion Diseases	Associate	23385535
Prostatic Neoplasms	Associate	11442674, 35627227, 38200609
Prostatitis	Associate	8957691
Pterygium	Associate	19758420
Rectal Neoplasms	Associate	33168793
Retinoblastoma	Associate	22457763
Retroperitoneal Neoplasms	Associate	28877062
Salivary Gland Neoplasms	Associate	36610231
Sarcoma	Associate	26216294, 32669612, 32957984, 33941195, 34723848, 35238118, 35645621, 37769113, 38065851
Sarcoma Clear Cell	Associate	32034283
Sarcoma Ewing	Associate	27145455, 8256848
Schizophrenia	Associate	22539856
Secretory breast carcinoma	Associate	35735423
Skin Neoplasms	Associate	28270164
Sleep Apnea Obstructive	Stimulate	17667845
Soft Tissue Neoplasms	Associate	32506523, 33077922
Solitary Fibrous Tumors	Associate	32034283, 36357104
Spondylitis Ankylosing	Associate	15817657
Squamous Cell Carcinoma of Head and Neck	Associate	29904026, 30360033, 35925599
Stomach Neoplasms	Inhibit	12854135
Stomach Neoplasms	Associate	26472021, 35008821
Synovitis	Associate	19490633
Tarlov Cysts	Associate	35925599
Thrombocythemia Essential	Associate	22385957
Thyroid Cancer Papillary	Associate	10646882, 19995698, 28052655, 28209747, 29214440, 29606586, 29610391, 30664823, 32187423, 33382403, 35333737, 37003481, 37236546, 37307878
Thyroid Carcinoma Anaplastic	Associate	28209747, 29037860
Thyroid Neoplasms	Associate	19797732, 22887574, 28013235, 29037860, 29610391, 32457407, 32737449, 33074583, 35015563, 35333737
Thyroid Nodule	Associate	21190444
Thyroiditis Autoimmune	Inhibit	33600668
Tinnitus	Associate	37736859
Triple Negative Breast Neoplasms	Associate	28590426, 31823098
Uniparental Disomy	Associate	11071380
Warts	Associate	31569353

NTRK1 (neurotrophic receptor tyrosine kinase 1)