NTF4 (neurotrophin 4)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 4909
Gene name Neurotrophin 4
Gene symbol NTF4
Synonyms (NCBI Gene)
GLC10GLC1ONT-4NT-4/5NT-5NT4NT5NTF5
Chromosome 19
Chromosome location 19q13.33
Summary This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neu
SNPs SNP information provided by dbSNP.
2
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
SNP ID Visualize variation Clinical significance Consequence
rs121918427 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs121918428 C>T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT022666 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (31)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005163 Function Nerve growth factor receptor binding IBA
GO:0005515 Function Protein binding IPI 10631974, 25241761, 25416956, 28514442, 29997244, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
162662 8024 ENSG00000225950
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P34130
Protein name Neurotrophin-4 (NT-4) (Neurotrophin-5) (NT-5) (Neutrophic factor 4)
Protein function Target-derived survival factor for peripheral sensory sympathetic neurons (PubMed:1742028). May promote ameloblast differentiation and subsequent reduction in proliferation of ameloblasts (By similarity). {ECO:0000250|UniProtKB:Q80VU4, ECO:00002
PDB 1B8M , 1B98 , 1HCF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF 89 → 208 Nerve growth factor family Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.
Sequence 
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL
TADAQGRVGWRWIRIDTACVCTLLSRTGRA
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway 		  Activated NTRK2 signals through PLCG1
Activated NTRK2 signals through FRS2 and FRS3
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Glaucoma 1, open angle, O Likely benign; no classifications from unflagged records rs61732310, rs121918427, rs121918428 RCV000015060
RCV000015061
RCV000015062
Intellectual disability, X-linked 99 Likely benign rs61732310 RCV001258310
NTF4-related disorder Likely benign; Benign rs374345134, rs200786116 RCV003924639
RCV003916185
Show/Hide Text Mining Associations (23)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28888073
Asthma Associate 12900521
Blood Platelet Disorders Associate 34546355
Carcinoma Non Small Cell Lung Associate 36034210
Cognitive Dysfunction Inhibit 28888073
Colorectal Neoplasms Associate 30884206
Congenital Abnormalities Associate 20806036
Conjunctivitis Allergic Stimulate 26989694
Dermatitis Atopic Stimulate 10844552
Drug Hypersensitivity Stimulate 12900521