NTF4 (neurotrophin 4)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4909
Gene name Gene Name - the full gene name approved by the HGNC.
Neurotrophin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NTF4
Synonyms (NCBI Gene) Gene synonyms aliases
GLC10, GLC1O, NT-4, NT-4/5, NT-5, NT4, NT5, NTF5
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neu
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs121918427 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs121918428 C>T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT022666 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005163 Function Nerve growth factor receptor binding IBA
GO:0005515 Function Protein binding IPI 10631974, 25241761, 25416956, 28514442, 29997244, 32296183, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
162662 8024 ENSG00000225950
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P34130
Protein name Neurotrophin-4 (NT-4) (Neurotrophin-5) (NT-5) (Neutrophic factor 4)
Protein function Target-derived survival factor for peripheral sensory sympathetic neurons (PubMed:1742028). May promote ameloblast differentiation and subsequent reduction in proliferation of ameloblasts (By similarity). {ECO:0000250|UniProtKB:Q80VU4, ECO:00002
PDB 1B8M , 1B98 , 1HCF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF 89 → 208 Nerve growth factor family Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.
Sequence 
MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFRESAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRAL
TADAQGRVGWRWIRIDTACVCTLLSRTGRA
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway 		  Activated NTRK2 signals through PLCG1
Activated NTRK2 signals through FRS2 and FRS3
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glaucoma glaucoma 1, open angle, O N/A N/A GenCC
Mental Retardation, X-Linked Intellectual disability, X-linked 99 N/A N/A ClinVar
Open Angle Glaucoma glaucoma 1, open angle, o N/A N/A ClinVar
Show/Hide Text Mining Associations (23)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28888073
Asthma Associate 12900521
Blood Platelet Disorders Associate 34546355
Carcinoma Non Small Cell Lung Associate 36034210
Cognitive Dysfunction Inhibit 28888073
Colorectal Neoplasms Associate 30884206
Congenital Abnormalities Associate 20806036
Conjunctivitis Allergic Stimulate 26989694
Dermatitis Atopic Stimulate 10844552
Drug Hypersensitivity Stimulate 12900521