NTF3 (neurotrophin 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4908
Gene name Gene Name - the full gene name approved by the HGNC.
Neurotrophin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NTF3
Synonyms (NCBI Gene) Gene synonyms aliases
HDNF, NGF-2, NGF2, NT-3, NT3
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
miRTarBase ID miRNA Experiments Reference
MIRT006797 hsa-miR-21-5p Luciferase reporter assay, qRT-PCR 22019057
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
FOS Unknown 7733919
ZNF175 Activation 19247725
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(33)
GO ID Ontology Definition Evidence Reference
GO:0002092 Process Positive regulation of receptor internalization IDA 23027130
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 2236018
GO:0005163 Function Nerve growth factor receptor binding IBA
GO:0005165 Function Neurotrophin receptor binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
162660 8023 ENSG00000185652
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P20783
Protein name Neurotrophin-3 (NT-3) (HDNF) (Nerve growth factor 2) (NGF-2) (Neurotrophic factor)
Protein function Seems to promote the survival of visceral and proprioceptive sensory neurons.
PDB 1B8K , 1BND , 1NT3 , 3BUK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF 144 → 255 Nerve growth factor family Domain
Tissue specificity TISSUE SPECIFICITY: Brain and peripheral tissues.
Sequence 
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT
Sequence length 257
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway 		  NTF3 activates NTRK3 signaling
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through PI3K
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hirschsprung Disease Hirschsprung disease, susceptibility to, 1 N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Show/Hide Text Mining Associations (43)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Valve Disease Associate 28356268
Asthma Associate 12900521
Breast Neoplasms Associate 23185507, 36263167
Carcinoma Hepatocellular Inhibit 36263167
Cholelithiasis Associate 39366640
Coronary Artery Disease Stimulate 37939716
Diverticular Diseases Associate 23805210
Dry Eye Syndromes Associate 39884388
Fibrous Dysplasia Polyostotic Stimulate 21059230
Frontotemporal Lobar Degeneration Associate 31081340