NTF3 (neurotrophin 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 4908
Gene name Neurotrophin 3
Gene symbol NTF3
Synonyms (NCBI Gene)
HDNFNGF-2NGF2NT-3NT3
Chromosome 12
Chromosome location 12p13.31
Summary The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved
miRNA miRNA information provided by mirtarbase database.
18
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (18)
miRTarBase ID miRNA Experiments Reference
MIRT006797 hsa-miR-21-5p Luciferase reporter assayqRT-PCR 22019057
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
MIRT007095 hsa-miR-200c-3p Luciferase reporter assay 23185507
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
FOS Unknown 7733919
ZNF175 Activation 19247725
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (33)
GO ID Ontology Definition Evidence Reference
GO:0002092 Process Positive regulation of receptor internalization IDA 23027130
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 2236018
GO:0005163 Function Nerve growth factor receptor binding IBA
GO:0005165 Function Neurotrophin receptor binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
162660 8023 ENSG00000185652
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20783
Protein name Neurotrophin-3 (NT-3) (HDNF) (Nerve growth factor 2) (NGF-2) (Neurotrophic factor)
Protein function Seems to promote the survival of visceral and proprioceptive sensory neurons.
PDB 1B8K , 1BND , 1NT3 , 3BUK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00243 NGF 144 → 255 Nerve growth factor family Domain
Tissue specificity TISSUE SPECIFICITY: Brain and peripheral tissues.
Sequence 
MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT
Sequence length 257
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  MAPK signaling pathway
Ras signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway 		  NTF3 activates NTRK3 signaling
Activated NTRK3 signals through PLCG1
Activated NTRK3 signals through PI3K
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Aganglionic megacolon Benign rs1805149 RCV000736041
Hirschsprung disease, susceptibility to, 1 Uncertain significance rs540320780 RCV000201299
Show/Hide Text Mining Associations (43)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Valve Disease Associate 28356268
Asthma Associate 12900521
Breast Neoplasms Associate 23185507, 36263167
Carcinoma Hepatocellular Inhibit 36263167
Cholelithiasis Associate 39366640
Coronary Artery Disease Stimulate 37939716
Diverticular Diseases Associate 23805210
Dry Eye Syndromes Associate 39884388
Fibrous Dysplasia Polyostotic Stimulate 21059230
Frontotemporal Lobar Degeneration Associate 31081340