Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4907
Gene name Gene Name - the full gene name approved by the HGNC.	5'-nucleotidase ecto
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NT5E
Synonyms (NCBI Gene) Gene synonyms aliases	CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CALJA
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q14.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene ca

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs373328681	C>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs387906620	G>A	Pathogenic	Missense variant, coding sequence variant
rs774200574	->A	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(301)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005130	hsa-miR-30a-5p	pSILAC	18668040
MIRT001529	hsa-miR-155-5p	pSILAC	18668040
MIRT001529	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT022996	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023955	hsa-miR-1-3p	Proteomics	18668040
MIRT025509	hsa-miR-34a-5p	Proteomics	21566225
MIRT005130	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT005130	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28158983
MIRT1195990	hsa-miR-106a	CLIP-seq
MIRT1195991	hsa-miR-106b	CLIP-seq
MIRT1195992	hsa-miR-1193	CLIP-seq
MIRT1195993	hsa-miR-142-5p	CLIP-seq
MIRT1195994	hsa-miR-17	CLIP-seq
MIRT1195995	hsa-miR-1914	CLIP-seq
MIRT1195996	hsa-miR-20a	CLIP-seq
MIRT1195997	hsa-miR-20b	CLIP-seq
MIRT1195998	hsa-miR-28-5p	CLIP-seq
MIRT1195999	hsa-miR-299-5p	CLIP-seq
MIRT1196000	hsa-miR-3139	CLIP-seq
MIRT1196001	hsa-miR-3144-3p	CLIP-seq
MIRT1196002	hsa-miR-340	CLIP-seq
MIRT1196003	hsa-miR-3609	CLIP-seq
MIRT1196004	hsa-miR-365	CLIP-seq
MIRT1196005	hsa-miR-4282	CLIP-seq
MIRT1196006	hsa-miR-4633-3p	CLIP-seq
MIRT1196007	hsa-miR-4720-3p	CLIP-seq
MIRT1196008	hsa-miR-4796-3p	CLIP-seq
MIRT1196009	hsa-miR-4804-3p	CLIP-seq
MIRT1196010	hsa-miR-513a-3p	CLIP-seq
MIRT1196011	hsa-miR-519d	CLIP-seq
MIRT1196012	hsa-miR-548ah	CLIP-seq
MIRT1196013	hsa-miR-592	CLIP-seq
MIRT1196014	hsa-miR-597	CLIP-seq
MIRT1196015	hsa-miR-708	CLIP-seq
MIRT1196016	hsa-miR-93	CLIP-seq
MIRT1551884	hsa-miR-1246	CLIP-seq
MIRT1551885	hsa-miR-30a	CLIP-seq
MIRT1551886	hsa-miR-30b	CLIP-seq
MIRT1551887	hsa-miR-30c	CLIP-seq
MIRT1551888	hsa-miR-30d	CLIP-seq
MIRT1551889	hsa-miR-30e	CLIP-seq
MIRT1551890	hsa-miR-3134	CLIP-seq
MIRT1551891	hsa-miR-320e	CLIP-seq
MIRT1551892	hsa-miR-380	CLIP-seq
MIRT1551893	hsa-miR-3924	CLIP-seq
MIRT1551894	hsa-miR-4495	CLIP-seq
MIRT1551895	hsa-miR-4534	CLIP-seq
MIRT1551896	hsa-miR-4803	CLIP-seq
MIRT1551897	hsa-miR-590-3p	CLIP-seq
MIRT1195992	hsa-miR-1193	CLIP-seq
MIRT2056866	hsa-miR-1236	CLIP-seq
MIRT2056867	hsa-miR-1827	CLIP-seq
MIRT2056868	hsa-miR-2392	CLIP-seq
MIRT2056869	hsa-miR-3120-5p	CLIP-seq
MIRT1551890	hsa-miR-3134	CLIP-seq
MIRT2056870	hsa-miR-3605-5p	CLIP-seq
MIRT2056871	hsa-miR-4453	CLIP-seq
MIRT2056872	hsa-miR-4455	CLIP-seq
MIRT1551895	hsa-miR-4534	CLIP-seq
MIRT2056873	hsa-miR-4538	CLIP-seq
MIRT2056874	hsa-miR-4684-3p	CLIP-seq
MIRT2056875	hsa-miR-4696	CLIP-seq
MIRT2056876	hsa-miR-556-5p	CLIP-seq
MIRT2056877	hsa-miR-579	CLIP-seq
MIRT2056878	hsa-miR-593	CLIP-seq
MIRT2056879	hsa-miR-609	CLIP-seq
MIRT2056880	hsa-miR-654-3p	CLIP-seq
MIRT2285340	hsa-miR-3163	CLIP-seq
MIRT2285341	hsa-miR-4452	CLIP-seq
MIRT2391778	hsa-miR-1301	CLIP-seq
MIRT2391779	hsa-miR-187	CLIP-seq
MIRT2391780	hsa-miR-3127-3p	CLIP-seq
MIRT2391781	hsa-miR-3176	CLIP-seq
MIRT2391782	hsa-miR-3615	CLIP-seq
MIRT2391783	hsa-miR-3667-3p	CLIP-seq
MIRT2391784	hsa-miR-3922-3p	CLIP-seq
MIRT2056872	hsa-miR-4455	CLIP-seq
MIRT2391785	hsa-miR-450b-5p	CLIP-seq
MIRT2391786	hsa-miR-4768-5p	CLIP-seq
MIRT2391787	hsa-miR-5047	CLIP-seq
MIRT2391788	hsa-miR-507	CLIP-seq
MIRT2391789	hsa-miR-557	CLIP-seq
MIRT2056879	hsa-miR-609	CLIP-seq
MIRT2431650	hsa-miR-2116	CLIP-seq
MIRT2431651	hsa-miR-218	CLIP-seq
MIRT2431652	hsa-miR-375	CLIP-seq
MIRT2431653	hsa-miR-4273	CLIP-seq
MIRT2431654	hsa-miR-4302	CLIP-seq
MIRT2431655	hsa-miR-4677-5p	CLIP-seq
MIRT1196007	hsa-miR-4720-3p	CLIP-seq
MIRT1196009	hsa-miR-4804-3p	CLIP-seq
MIRT2431656	hsa-miR-502-5p	CLIP-seq
MIRT2431657	hsa-miR-548a-3p	CLIP-seq
MIRT2431658	hsa-miR-548e	CLIP-seq
MIRT2431659	hsa-miR-548f	CLIP-seq
MIRT2431660	hsa-miR-636	CLIP-seq
MIRT2431661	hsa-miR-648	CLIP-seq
MIRT2431662	hsa-miR-662	CLIP-seq
MIRT2431663	hsa-miR-9	CLIP-seq
MIRT2056866	hsa-miR-1236	CLIP-seq
MIRT2439075	hsa-miR-125a-5p	CLIP-seq
MIRT2439076	hsa-miR-125b	CLIP-seq
MIRT2056869	hsa-miR-3120-5p	CLIP-seq
MIRT2439077	hsa-miR-3714	CLIP-seq
MIRT2439078	hsa-miR-374a	CLIP-seq
MIRT2439079	hsa-miR-374b	CLIP-seq
MIRT2439080	hsa-miR-4319	CLIP-seq
MIRT2439081	hsa-miR-4719	CLIP-seq
MIRT2439082	hsa-miR-4725-5p	CLIP-seq
MIRT2439083	hsa-miR-504	CLIP-seq
MIRT2439084	hsa-miR-548an	CLIP-seq
MIRT2056877	hsa-miR-579	CLIP-seq
MIRT2056878	hsa-miR-593	CLIP-seq
MIRT2056880	hsa-miR-654-3p	CLIP-seq
MIRT2439075	hsa-miR-125a-5p	CLIP-seq
MIRT2439076	hsa-miR-125b	CLIP-seq
MIRT2056869	hsa-miR-3120-5p	CLIP-seq
MIRT2439080	hsa-miR-4319	CLIP-seq
MIRT2439082	hsa-miR-4725-5p	CLIP-seq
MIRT2439083	hsa-miR-504	CLIP-seq
MIRT2056878	hsa-miR-593	CLIP-seq
MIRT2056880	hsa-miR-654-3p	CLIP-seq
MIRT2583371	hsa-miR-105	CLIP-seq
MIRT1195990	hsa-miR-106a	CLIP-seq
MIRT1195991	hsa-miR-106b	CLIP-seq
MIRT1195992	hsa-miR-1193	CLIP-seq
MIRT2583372	hsa-miR-124	CLIP-seq
MIRT1195993	hsa-miR-142-5p	CLIP-seq
MIRT2583373	hsa-miR-153	CLIP-seq
MIRT2583374	hsa-miR-154	CLIP-seq
MIRT1195994	hsa-miR-17	CLIP-seq
MIRT1195995	hsa-miR-1914	CLIP-seq
MIRT1195996	hsa-miR-20a	CLIP-seq
MIRT1195997	hsa-miR-20b	CLIP-seq
MIRT2431650	hsa-miR-2116	CLIP-seq
MIRT2583375	hsa-miR-216a	CLIP-seq
MIRT2431651	hsa-miR-218	CLIP-seq
MIRT2056868	hsa-miR-2392	CLIP-seq
MIRT1195998	hsa-miR-28-5p	CLIP-seq
MIRT2583376	hsa-miR-298	CLIP-seq
MIRT2583377	hsa-miR-3121-3p	CLIP-seq
MIRT2583378	hsa-miR-3124-3p	CLIP-seq
MIRT1196000	hsa-miR-3139	CLIP-seq
MIRT1196001	hsa-miR-3144-3p	CLIP-seq
MIRT2583379	hsa-miR-3148	CLIP-seq
MIRT2583380	hsa-miR-3153	CLIP-seq
MIRT2583381	hsa-miR-3156-3p	CLIP-seq
MIRT2285340	hsa-miR-3163	CLIP-seq
MIRT2583382	hsa-miR-3180-5p	CLIP-seq
MIRT2583383	hsa-miR-3201	CLIP-seq
MIRT2583384	hsa-miR-338-3p	CLIP-seq
MIRT1196002	hsa-miR-340	CLIP-seq
MIRT2056870	hsa-miR-3605-5p	CLIP-seq
MIRT1196003	hsa-miR-3609	CLIP-seq
MIRT2583385	hsa-miR-3614-5p	CLIP-seq
MIRT2583386	hsa-miR-3685	CLIP-seq
MIRT2583387	hsa-miR-3691-5p	CLIP-seq
MIRT2439077	hsa-miR-3714	CLIP-seq
MIRT2431652	hsa-miR-375	CLIP-seq
MIRT2583388	hsa-miR-382	CLIP-seq
MIRT2583389	hsa-miR-384	CLIP-seq
MIRT2583390	hsa-miR-3945	CLIP-seq
MIRT2583391	hsa-miR-3975	CLIP-seq
MIRT2583392	hsa-miR-3976	CLIP-seq
MIRT2583393	hsa-miR-4253	CLIP-seq
MIRT2583394	hsa-miR-4256	CLIP-seq
MIRT2583395	hsa-miR-4257	CLIP-seq
MIRT2431653	hsa-miR-4273	CLIP-seq
MIRT2583396	hsa-miR-4301	CLIP-seq
MIRT2431654	hsa-miR-4302	CLIP-seq
MIRT2583397	hsa-miR-4310	CLIP-seq
MIRT2583398	hsa-miR-4422	CLIP-seq
MIRT2056872	hsa-miR-4455	CLIP-seq
MIRT2583399	hsa-miR-4530	CLIP-seq
MIRT1196006	hsa-miR-4633-3p	CLIP-seq
MIRT2583400	hsa-miR-4668-5p	CLIP-seq
MIRT2583401	hsa-miR-4670-3p	CLIP-seq
MIRT2431655	hsa-miR-4677-5p	CLIP-seq
MIRT2056874	hsa-miR-4684-3p	CLIP-seq
MIRT2056875	hsa-miR-4696	CLIP-seq
MIRT2583402	hsa-miR-4717-3p	CLIP-seq
MIRT2439081	hsa-miR-4719	CLIP-seq
MIRT1196007	hsa-miR-4720-3p	CLIP-seq
MIRT2583403	hsa-miR-4752	CLIP-seq
MIRT2583404	hsa-miR-4753-3p	CLIP-seq
MIRT2583405	hsa-miR-4762-3p	CLIP-seq
MIRT2583406	hsa-miR-4772-3p	CLIP-seq
MIRT2583407	hsa-miR-4791	CLIP-seq
MIRT2583408	hsa-miR-4795-3p	CLIP-seq
MIRT1196008	hsa-miR-4796-3p	CLIP-seq
MIRT1196009	hsa-miR-4804-3p	CLIP-seq
MIRT2583409	hsa-miR-506	CLIP-seq
MIRT1196011	hsa-miR-519d	CLIP-seq
MIRT2431657	hsa-miR-548a-3p	CLIP-seq
MIRT1196012	hsa-miR-548ah	CLIP-seq
MIRT2439084	hsa-miR-548an	CLIP-seq
MIRT2431658	hsa-miR-548e	CLIP-seq
MIRT2431659	hsa-miR-548f	CLIP-seq
MIRT2583410	hsa-miR-552	CLIP-seq
MIRT2583411	hsa-miR-586	CLIP-seq
MIRT2056879	hsa-miR-609	CLIP-seq
MIRT2431660	hsa-miR-636	CLIP-seq
MIRT2431661	hsa-miR-648	CLIP-seq
MIRT2431662	hsa-miR-662	CLIP-seq
MIRT1196015	hsa-miR-708	CLIP-seq
MIRT2431663	hsa-miR-9	CLIP-seq
MIRT2583412	hsa-miR-922	CLIP-seq
MIRT1196016	hsa-miR-93	CLIP-seq
MIRT2583371	hsa-miR-105	CLIP-seq
MIRT1195990	hsa-miR-106a	CLIP-seq
MIRT1195991	hsa-miR-106b	CLIP-seq
MIRT1195992	hsa-miR-1193	CLIP-seq
MIRT2583372	hsa-miR-124	CLIP-seq
MIRT2686647	hsa-miR-1285	CLIP-seq
MIRT1195993	hsa-miR-142-5p	CLIP-seq
MIRT2583373	hsa-miR-153	CLIP-seq
MIRT1195994	hsa-miR-17	CLIP-seq
MIRT2056867	hsa-miR-1827	CLIP-seq
MIRT1195995	hsa-miR-1914	CLIP-seq
MIRT2686648	hsa-miR-205	CLIP-seq
MIRT1195996	hsa-miR-20a	CLIP-seq
MIRT1195997	hsa-miR-20b	CLIP-seq
MIRT2431650	hsa-miR-2116	CLIP-seq
MIRT2056868	hsa-miR-2392	CLIP-seq
MIRT1195998	hsa-miR-28-5p	CLIP-seq
MIRT2583376	hsa-miR-298	CLIP-seq
MIRT2583377	hsa-miR-3121-3p	CLIP-seq
MIRT2583378	hsa-miR-3124-3p	CLIP-seq
MIRT2686649	hsa-miR-3126-3p	CLIP-seq
MIRT1196000	hsa-miR-3139	CLIP-seq
MIRT1196001	hsa-miR-3144-3p	CLIP-seq
MIRT2583379	hsa-miR-3148	CLIP-seq
MIRT2583380	hsa-miR-3153	CLIP-seq
MIRT2583381	hsa-miR-3156-3p	CLIP-seq
MIRT2285340	hsa-miR-3163	CLIP-seq
MIRT2583382	hsa-miR-3180-5p	CLIP-seq
MIRT2686650	hsa-miR-3187-5p	CLIP-seq
MIRT2583383	hsa-miR-3201	CLIP-seq
MIRT2583384	hsa-miR-338-3p	CLIP-seq
MIRT1196002	hsa-miR-340	CLIP-seq
MIRT2056870	hsa-miR-3605-5p	CLIP-seq
MIRT1196003	hsa-miR-3609	CLIP-seq
MIRT2583386	hsa-miR-3685	CLIP-seq
MIRT2583387	hsa-miR-3691-5p	CLIP-seq
MIRT2431652	hsa-miR-375	CLIP-seq
MIRT2686651	hsa-miR-378g	CLIP-seq
MIRT2583388	hsa-miR-382	CLIP-seq
MIRT2583389	hsa-miR-384	CLIP-seq
MIRT2583390	hsa-miR-3945	CLIP-seq
MIRT2583391	hsa-miR-3975	CLIP-seq
MIRT2583392	hsa-miR-3976	CLIP-seq
MIRT2583393	hsa-miR-4253	CLIP-seq
MIRT2583394	hsa-miR-4256	CLIP-seq
MIRT2583395	hsa-miR-4257	CLIP-seq
MIRT2431653	hsa-miR-4273	CLIP-seq
MIRT2583396	hsa-miR-4301	CLIP-seq
MIRT2431654	hsa-miR-4302	CLIP-seq
MIRT2583397	hsa-miR-4310	CLIP-seq
MIRT2056872	hsa-miR-4455	CLIP-seq
MIRT2686652	hsa-miR-4486	CLIP-seq
MIRT2583399	hsa-miR-4530	CLIP-seq
MIRT1196006	hsa-miR-4633-3p	CLIP-seq
MIRT2583400	hsa-miR-4668-5p	CLIP-seq
MIRT2431655	hsa-miR-4677-5p	CLIP-seq
MIRT2056874	hsa-miR-4684-3p	CLIP-seq
MIRT2056875	hsa-miR-4696	CLIP-seq
MIRT2583402	hsa-miR-4717-3p	CLIP-seq
MIRT1196007	hsa-miR-4720-3p	CLIP-seq
MIRT2686653	hsa-miR-4724-3p	CLIP-seq
MIRT2583403	hsa-miR-4752	CLIP-seq
MIRT2583404	hsa-miR-4753-3p	CLIP-seq
MIRT2583405	hsa-miR-4762-3p	CLIP-seq
MIRT2583406	hsa-miR-4772-3p	CLIP-seq
MIRT2583407	hsa-miR-4791	CLIP-seq
MIRT2583408	hsa-miR-4795-3p	CLIP-seq
MIRT1196008	hsa-miR-4796-3p	CLIP-seq
MIRT2583409	hsa-miR-506	CLIP-seq
MIRT1196011	hsa-miR-519d	CLIP-seq
MIRT1196012	hsa-miR-548ah	CLIP-seq
MIRT2439084	hsa-miR-548an	CLIP-seq
MIRT2583410	hsa-miR-552	CLIP-seq
MIRT2686654	hsa-miR-583	CLIP-seq
MIRT2583411	hsa-miR-586	CLIP-seq
MIRT2056879	hsa-miR-609	CLIP-seq
MIRT2686655	hsa-miR-612	CLIP-seq
MIRT2431662	hsa-miR-662	CLIP-seq
MIRT1196015	hsa-miR-708	CLIP-seq
MIRT2431663	hsa-miR-9	CLIP-seq
MIRT2583412	hsa-miR-922	CLIP-seq
MIRT1196016	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
HIF1A	Activation	12370277
HNF1A	Unknown	10428853
LEF1	Unknown	10428853
SP1	Unknown	10428853

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006195	Process	Purine nucleotide catabolic process	TAS
GO:0006196	Process	AMP catabolic process	IBA	21873635
GO:0006259	Process	DNA metabolic process	TAS	2129526
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	7595232
GO:0008253	Function	5'-nucleotidase activity	IBA	21873635
GO:0008253	Function	5'-nucleotidase activity	IDA	7595232
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0016020	Component	Membrane	TAS	2129526
GO:0016311	Process	Dephosphorylation	IEA
GO:0019674	Process	NAD metabolic process	TAS
GO:0031225	Component	Anchored component of membrane	IEA
GO:0046086	Process	Adenosine biosynthetic process	IEA
GO:0046135	Process	Pyrimidine nucleoside catabolic process	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 21362503, 23533145

MIM	HGNC	e!Ensembl
129190	8021	ENSG00000135318

Protein

UniProt ID

P21589

Protein name

5'-nucleotidase (5'-NT) (EC 3.1.3.35) (EC 3.1.3.5) (EC 3.1.3.89) (EC 3.1.3.91) (EC 3.1.3.99) (5'-deoxynucleotidase) (Ecto-5'-nucleotidase) (IMP-specific 5'-nucleotidase) (Thymidylate 5'-phosphatase) (CD antigen CD73)

Protein function

Catalyzes the hydrolysis of nucleotide monophosphates, releasing inorganic phosphate and the corresponding nucleoside, with AMP being the preferred substrate (PubMed:21933152, PubMed:22997138, PubMed:23142347, PubMed:24887587, PubMed:34403084).

PDB

4H1S , 4H1Y , 4H2B , 4H2F , 4H2G , 4H2I , 6HXW , 6S7F , 6S7H , 6TVE , 6TVG , 6TVX , 6TW0 , 6TWA , 6TWF , 6VC9 , 6VCA , 6XUE , 6XUG , 6XUQ , 6YE1 , 6YE2 , 6Z9B , 6Z9D , 7BBJ , 7JV8 , 7JV9 , 7P9N , 7P9R , 7P9T , 7PA4 , 7PB5 , 7PBA , 7PBB , 7PBY , 7PCP , 7PD9 , 7QGA , 7QGL , 7QGM , 7QGO , 8ZNZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	29 → 246	Calcineurin-like phosphoesterase	Domain
PF02872	5_nucleotid_C	338 → 513		Domain

Sequence

MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ

Sequence length

574

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Nicotinate and nicotinamide metabolism Metabolic pathways Nucleotide metabolism		Nicotinate metabolism Pyrimidine catabolism Purine catabolism Purinergic signaling in leishmaniasis infection

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Arterial tortuosity syndrome	ARTERIAL TORTUOSITY SYNDROME	rs80358229, rs587776599, rs587776600, rs80358230, rs121908172, rs121908173, rs767864243, rs572620317, rs756457861, rs146579504, rs771028960, rs864309481, rs763220502, rs370547023, rs753723351 View all (5 more)
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16367923
Hereditary arterial and articular multiple calcification syndrome	Hereditary arterial and articular multiple calcification syndrome	rs373328681, rs387906620, rs774200574

Show/Hide Text Mining Associations (181)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	24310606, 25677906, 26113408, 28060732
Adenocarcinoma	Stimulate	29514610
Adenocarcinoma in Situ	Stimulate	33416944
Adenocarcinoma of Lung	Associate	33416944, 34996932, 35813221, 38149244
Agammaglobulinemia	Associate	2843575
Alopecia	Associate	35181715
alpha Thalassemia	Stimulate	24074530
Alveolitis Extrinsic Allergic	Inhibit	27792269
Anemia Sickle Cell	Associate	26316481
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	28916770
Aortic Aneurysm Abdominal	Associate	35115574
Aortic Valve Calcification of	Associate	34999808
Aortic Valve Stenosis	Associate	34999808
Arthritis	Associate	25418634
Arthritis Juvenile	Inhibit	25418634
Arthritis Rheumatoid	Associate	24990235, 38275742
Ataxia	Associate	34999808
Atherosclerosis	Associate	27832456
Brain Injuries Traumatic	Associate	26040919, 32024452
Breast Neoplasms	Associate	17471030, 17671792, 18062933, 1989648, 22653144, 23086814, 31770109, 32345959, 34741235, 35617355, 38235137, 40612859
Bruton type agammaglobulinemia	Associate	6316584
Calcification of Joints and Arteries	Associate	21288095, 21371928, 32375544, 32522903, 34999808
Calcinosis	Associate	21371928
Calcinosis Cutis	Associate	22454080
Calciphylaxis	Associate	28212442
Carcinogenesis	Associate	29551673, 34019179, 36870289
Carcinoma	Associate	34019179
Carcinoma	Stimulate	35558159
Carcinoma Acinar Cell	Associate	35902382
Carcinoma Adenoid Cystic	Associate	35902382
Carcinoma Hepatocellular	Associate	30607549, 32024555, 34838121
Carcinoma in Situ	Associate	26543299
Carcinoma Non Small Cell Lung	Associate	28060732, 28878242, 32061060, 32096481, 33123122, 34290905, 34740105, 34862113, 37016126, 37218137, 37364849, 37648263
Carcinoma Pancreatic Ductal	Associate	30607549, 32676968, 33820913, 33832821, 35485681, 37016126
Carcinoma Papillary	Stimulate	34019179
Carcinoma Renal Cell	Associate	33177176
Cardiovascular Diseases	Associate	37016126
Cerebral Infarction	Inhibit	32344922
Cholangiocarcinoma	Associate	30607549, 36899373
Choristoma	Associate	21288095
Chronic Limb Threatening Ischemia	Associate	32522903
Colonic Neoplasms	Associate	36881132
Colorectal Neoplasms	Associate	24133572, 30719834, 30918427, 30932882, 32363113, 34165921, 34980880, 35563553, 37016126, 37501197, 38164172
Colorectal Neoplasms	Inhibit	36881132
Coronary Aneurysm	Associate	30985656
Coronary Artery Disease	Associate	30985656
Coronary Disease	Associate	24736300
COVID 19	Associate	32707842, 36248842, 38139439
COVID 19	Inhibit	33617048
Crohn Disease	Associate	19253308
Cytomegalovirus Infections	Inhibit	21536322
Death	Associate	35115574
Dermatitis Herpetiformis	Associate	22991566
Dermatomyositis	Associate	32846838
Diabetes Gestational	Associate	25437179
Diabetic Nephropathies	Associate	32289379
Drug Related Side Effects and Adverse Reactions	Associate	20855458, 34208001
Endometrial Hyperplasia	Stimulate	33416944
Endometrial Neoplasms	Associate	19228591, 24707115
Endometriosis	Associate	31698766
Eosinophilia	Associate	6326896
Eosinophilic Esophagitis	Associate	32426497
Epilepsy Familial Mesial Temporal Lobe	Stimulate	27650530
Epilepsy Familial Mesial Temporal Lobe	Associate	27650530
Esophageal Neoplasms	Associate	28397110
External Auditory Canal Bilateral Atresia Of With Congenital Vertical Talus	Associate	32473077
Fatigue	Associate	37016126
Fatigue Syndrome Chronic	Associate	16049284
Fractures Spontaneous	Associate	27650530
Gallbladder Neoplasms	Associate	24310606, 35163489
Gallbladder Neoplasms	Stimulate	34876625
Glioblastoma	Associate	33268695, 35973991, 37402102, 39709472, 40191718
Gliosis	Associate	27650530
Glutaric Acidemia I	Stimulate	37481646
Graves Ophthalmopathy	Associate	26325413
Head and Neck Neoplasms	Associate	32548862, 37620936
Heart Arrest	Associate	31237169
Heart Diseases	Associate	30985656
Hereditary Breast and Ovarian Cancer Syndrome	Associate	29514610
HIV Infections	Associate	24005375, 33477692, 35444646, 35529864
HIV Infections	Inhibit	35325005
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25201977
Hypertension Pregnancy Induced	Associate	40243452
Hypothyroidism	Associate	29090621
Hypoxia	Associate	27832456, 34863899, 35973991, 37910505
Hypoxia	Stimulate	35622118
Hypoxia Brain	Stimulate	37910505
Idiopathic Pulmonary Fibrosis	Stimulate	20169073
Immune Reconstitution Inflammatory Syndrome	Associate	35444646
Inflammation	Associate	17471030, 19253308, 21536322, 25418634, 27832456, 30808894, 31237169, 31409424, 32024452, 32707842, 33072107, 33416944, 34666225, 35325005, 35529864, 35973991, 36499469 View all (2 more)
Inflammation	Stimulate	22965858
Inflammation	Inhibit	32673430, 34299260
Inflammatory Bowel Diseases	Associate	19253308, 22965858
Intermittent Claudication	Associate	32522903
Intervertebral Disc Degeneration	Associate	39332686
Ischemia	Associate	20679180
Kidney Diseases	Associate	34299260
Leukemia	Associate	11535530, 2070084, 27718302
Leukemia B Cell	Associate	2070084
Leukemia Lymphocytic Chronic B Cell	Associate	15454483, 21816376, 21998208, 29976738
Leukemia Lymphocytic Chronic B Cell	Inhibit	6331548
Leukemia Lymphoid	Associate	6326896
Leukemia Myeloid Acute	Associate	11535530, 23873772, 31014364, 34211801
Leukemia T Cell	Associate	2070084
Lung Diseases	Associate	29514610
Lung Diseases	Stimulate	33123122
Lung Neoplasms	Associate	33123122
Lupus Erythematosus Systemic	Associate	34666225
Lupus Erythematosus Systemic	Inhibit	36314527
Lymphatic Metastasis	Associate	23653114, 29514610, 32676968
Lymphatic Metastasis	Stimulate	30932882, 30992388, 40612859
Lymphoma Follicular	Associate	37899130
Lymphoma Large B Cell Diffuse	Associate	35365585, 40461625
Malaria	Inhibit	33617048
Medulloblastoma	Associate	23094051
Melanoma	Associate	22454080, 32160899, 32426497, 35273100, 36131912, 36522571, 37517292
Melanoma	Stimulate	33361405
Melanoma Cutaneous Malignant	Associate	37768408
Mouth Neoplasms	Associate	37392167
Multiple Myeloma	Inhibit	2982438
Multiple Myeloma	Associate	35365613
Multiple Sclerosis	Associate	18825744, 35325005
Muscular Dystrophy Duchenne	Associate	34922439
Musculoskeletal Pain	Associate	36969257
Native American myopathy	Associate	23880765
Neoplasm Metastasis	Inhibit	22653144
Neoplasm Metastasis	Associate	23094051, 27270314, 28202050, 30203045, 30932882, 32363113, 34159752, 35813221, 36091055, 37274903, 37620936, 40612859
Neoplasm Metastasis	Stimulate	23569336, 30992388, 36881132, 38164172
Neoplasm Residual	Associate	35235138
Neoplasms	Associate	16644754, 17471030, 1989648, 22454080, 22653144, 23094051, 23880765, 24133572, 24310606, 24707115, 24749746, 25080434, 25677906, 26543299, 28033303 View all (60 more)
Neoplasms	Stimulate	23569336, 23653114, 31770109, 33820913, 34165921, 35485681
Neoplasms	Inhibit	32643277, 36131912, 37392167, 37409119
Nephrosis Lipoid	Associate	34299260
Nephrotic Syndrome	Associate	33785019
Nerve Degeneration	Associate	27650530
Neuroblastoma	Associate	33452207
Osteoarthritis	Inhibit	32245507
Osteoporosis	Associate	32245507
Ovarian Neoplasms	Stimulate	29514610
Ovarian Neoplasms	Associate	29551673, 29559470
Pancreatic Neoplasms	Associate	31879272, 32643277, 37260110, 37291128
Papillomavirus Infections	Associate	31205451
Paraproteinemias	Inhibit	2982438
Peripheral Arterial Disease	Associate	27832456, 32375544
Phyllodes Tumor of the Prostate	Associate	37092584
Plaque Atherosclerotic	Associate	27832456
Pre Eclampsia	Associate	40243452
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27718302
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35235138, 40076750, 40362518
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12060121
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	6309282
Prostatic Hyperplasia	Associate	37092584
Prostatic Neoplasms	Associate	23653114, 28033303, 30488530, 37092584
Pseudoxanthoma Elasticum	Associate	31646622
Psoriasis	Associate	35848967
Pulmonary Disease Chronic Obstructive	Stimulate	20169073
Renal cell carcinoma 1	Associate	31205451
Reticuloendotheliosis X linked	Associate	6326896
Salivary Gland Neoplasms	Associate	35902382
Sarcoma	Associate	31510956
Sarcoma Ewing	Associate	37471463
Seizures	Associate	26040919, 27650530
Severe Combined Immunodeficiency	Associate	6326896
Sjogren's Syndrome	Associate	34386009
Soft Tissue Injuries	Associate	31237169
Squamous Cell Carcinoma of Head and Neck	Associate	19825957, 25647013, 27281619, 36091055, 36268020, 36466881
Squamous Cell Carcinoma of Head and Neck	Stimulate	35657703
Squamous Intraepithelial Lesions	Associate	33488292
Stomach Neoplasms	Associate	16367923, 23569336, 29514610, 30992388, 31930120, 34637682
Stress Disorders Post Traumatic	Associate	26040919
T cell immunodeficiency primary	Associate	2843575
Tarlov Cysts	Associate	32676968
Tertiary Lymphoid Structures	Stimulate	23653114
Thyroid Cancer Papillary	Associate	34019179
Triple Negative Breast Neoplasms	Associate	29145561, 40612859
Urinary Bladder Neoplasms	Associate	26543299, 29305710, 36870289, 38518167
Uterine Cervical Neoplasms	Associate	28202050, 31198791, 31205451, 33488292, 36070413, 40141056
Vascular Calcification	Associate	21288095, 34922439
Vascular Ring	Associate	35712246
Vasculitis	Inhibit	28916770
Wounds and Injuries	Associate	34299260

NT5E (5'-nucleotidase ecto)