Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4904
Gene name	Y-box binding protein 1
Gene symbol	YBX1
Synonyms (NCBI Gene)	BP-8CBF-ACSDA2CSDBDBPBEFI-AMDR-NF1NSEP-1NSEP1YB-1YB1
Chromosome	1
Chromosome location	1p34.2
Summary	This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007092	hsa-miR-137	Luciferase reporter assay	23178914
MIRT007092	hsa-miR-137	Luciferase reporter assay	23178914
MIRT022450	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT031527	hsa-miR-16-5p	Proteomics	18668040
MIRT050595	hsa-miR-20a-5p	CLASH	23622248
MIRT050297	hsa-miR-25-3p	CLASH	23622248
MIRT047343	hsa-miR-34a-5p	CLASH	23622248
MIRT045400	hsa-miR-149-5p	CLASH	23622248
MIRT044272	hsa-miR-106b-5p	CLASH	23622248
MIRT041860	hsa-miR-484	CLASH	23622248
MIRT040476	hsa-miR-605-5p	CLASH	23622248
MIRT039737	hsa-miR-615-3p	CLASH	23622248
MIRT037523	hsa-miR-744-5p	CLASH	23622248
MIRT036695	hsa-miR-935	CLASH	23622248
MIRT036078	hsa-miR-1296-5p	CLASH	23622248
MIRT035829	hsa-miR-1292-5p	CLASH	23622248
MIRT035821	hsa-miR-1307-3p	CLASH	23622248
MIRT007092	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	23151846
MIRT007092	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	23151846
MIRT007092	hsa-miR-137	Luciferase reporter assayqRT-PCRWestern blot	24465609
MIRT463791	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT463787	hsa-miR-8069	PAR-CLIP	20371350
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	20371350
MIRT341355	hsa-miR-4451	PAR-CLIP	20371350
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT463791	hsa-miR-379-5p	PAR-CLIP	24398324
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	24398324
MIRT463787	hsa-miR-8069	PAR-CLIP	24398324
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	24398324
MIRT341355	hsa-miR-4451	PAR-CLIP	24398324
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT463791	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	23592263
MIRT463788	hsa-miR-6831-3p	PAR-CLIP	23592263
MIRT463787	hsa-miR-8069	PAR-CLIP	23592263
MIRT341357	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT341355	hsa-miR-4451	PAR-CLIP	23592263
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT731079	hsa-miR-382-5p	qRT-PCRLuciferase reporter assayWestern blot	25292190
MIRT731079	hsa-miR-382-5p	qRT-PCRLuciferase reporter assayWestern blot	25292190
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	26701625
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	26701625
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	26701625
MIRT463791	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT463791	hsa-miR-379-5p	PAR-CLIP	26701625
MIRT341355	hsa-miR-4451	PAR-CLIP	26701625
MIRT341355	hsa-miR-4451	PAR-CLIP	26701625
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	26701625
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT463787	hsa-miR-8069	PAR-CLIP	26701625
MIRT463787	hsa-miR-8069	PAR-CLIP	26701625
MIRT731079	hsa-miR-382-5p	qRT-PCR	31417288
MIRT463791	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	20371350
MIRT463787	hsa-miR-8069	PAR-CLIP	20371350
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	20371350
MIRT341355	hsa-miR-4451	PAR-CLIP	20371350
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT463791	hsa-miR-379-5p	PAR-CLIP	24398324
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	24398324
MIRT463787	hsa-miR-8069	PAR-CLIP	24398324
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	24398324
MIRT341355	hsa-miR-4451	PAR-CLIP	24398324
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	24398324
MIRT463791	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT463790	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT463789	hsa-miR-1537-3p	PAR-CLIP	23592263
MIRT463788	hsa-miR-6831-3p	PAR-CLIP	23592263
MIRT463787	hsa-miR-8069	PAR-CLIP	23592263
MIRT341357	hsa-miR-6744-5p	PAR-CLIP	23592263
MIRT463786	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT341355	hsa-miR-4451	PAR-CLIP	23592263
MIRT341358	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT1498323	hsa-miR-1206	CLIP-seq
MIRT1498324	hsa-miR-1255a	CLIP-seq
MIRT1498325	hsa-miR-1255b	CLIP-seq
MIRT1498326	hsa-miR-1273f	CLIP-seq
MIRT1498327	hsa-miR-1279	CLIP-seq
MIRT1498328	hsa-miR-1287	CLIP-seq
MIRT1498329	hsa-miR-129-5p	CLIP-seq
MIRT1498330	hsa-miR-1537	CLIP-seq
MIRT1498331	hsa-miR-208a	CLIP-seq
MIRT1498332	hsa-miR-208b	CLIP-seq
MIRT1498333	hsa-miR-30a	CLIP-seq
MIRT1498334	hsa-miR-30b	CLIP-seq
MIRT1498335	hsa-miR-30c	CLIP-seq
MIRT1498336	hsa-miR-30d	CLIP-seq
MIRT1498337	hsa-miR-30e	CLIP-seq
MIRT1498338	hsa-miR-3119	CLIP-seq
MIRT1498339	hsa-miR-3135b	CLIP-seq
MIRT1498340	hsa-miR-3529	CLIP-seq
MIRT1498341	hsa-miR-3658	CLIP-seq
MIRT1498342	hsa-miR-3667-5p	CLIP-seq
MIRT1498343	hsa-miR-375	CLIP-seq
MIRT1498344	hsa-miR-379	CLIP-seq
MIRT1498345	hsa-miR-382	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT1498348	hsa-miR-4477a	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498352	hsa-miR-499-5p	CLIP-seq
MIRT1498353	hsa-miR-520d-5p	CLIP-seq
MIRT1498354	hsa-miR-524-5p	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT1498362	hsa-miR-556-3p	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498364	hsa-miR-579	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498324	hsa-miR-1255a	CLIP-seq
MIRT1498325	hsa-miR-1255b	CLIP-seq
MIRT1498326	hsa-miR-1273f	CLIP-seq
MIRT2150092	hsa-miR-153	CLIP-seq
MIRT1498330	hsa-miR-1537	CLIP-seq
MIRT2150093	hsa-miR-3126-3p	CLIP-seq
MIRT2150094	hsa-miR-3168	CLIP-seq
MIRT1498340	hsa-miR-3529	CLIP-seq
MIRT2150095	hsa-miR-3663-5p	CLIP-seq
MIRT1498344	hsa-miR-379	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT2150100	hsa-miR-577	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT2150092	hsa-miR-153	CLIP-seq
MIRT2150093	hsa-miR-3126-3p	CLIP-seq
MIRT2150095	hsa-miR-3663-5p	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498358	hsa-miR-548c-3p	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT2150100	hsa-miR-577	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498369	hsa-miR-95	CLIP-seq
MIRT1498327	hsa-miR-1279	CLIP-seq
MIRT1498346	hsa-miR-4327	CLIP-seq
MIRT1498348	hsa-miR-4477a	CLIP-seq
MIRT1498349	hsa-miR-4659a-3p	CLIP-seq
MIRT1498350	hsa-miR-4659b-3p	CLIP-seq
MIRT1498351	hsa-miR-4778-3p	CLIP-seq
MIRT1498361	hsa-miR-552	CLIP-seq
MIRT1498363	hsa-miR-578	CLIP-seq
MIRT1498366	hsa-miR-636	CLIP-seq
MIRT1498367	hsa-miR-653	CLIP-seq
MIRT1498368	hsa-miR-764	CLIP-seq
MIRT1498338	hsa-miR-3119	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT2663964	hsa-miR-4484	CLIP-seq
MIRT2663965	hsa-miR-494	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT2663966	hsa-miR-548an	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq
MIRT1498347	hsa-miR-4461	CLIP-seq
MIRT2663964	hsa-miR-4484	CLIP-seq
MIRT2663965	hsa-miR-494	CLIP-seq
MIRT1498355	hsa-miR-539	CLIP-seq
MIRT1498356	hsa-miR-548aa	CLIP-seq
MIRT1498357	hsa-miR-548ac	CLIP-seq
MIRT2150096	hsa-miR-548ae	CLIP-seq
MIRT2150097	hsa-miR-548aj	CLIP-seq
MIRT2150098	hsa-miR-548am	CLIP-seq
MIRT2663966	hsa-miR-548an	CLIP-seq
MIRT1498359	hsa-miR-548d-3p	CLIP-seq
MIRT2150099	hsa-miR-548x	CLIP-seq
MIRT1498360	hsa-miR-548z	CLIP-seq
MIRT1498365	hsa-miR-580	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
TWIST1	Activation	21876555
TWIST1	Unknown	19318582

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000932	Component	P-body	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0003676	Function	Nucleic acid binding	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2977358, 3174636, 8188694
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	TAS	1738588
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	19561594, 28341602
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12674497, 15229244, 16797541, 17289661, 17572683, 17932509, 18335541, 18809583, 18851979, 19174163, 20856196, 21145461, 21653829, 21849455, 22118625, 22365833, 23986595, 24965446, 24981860, 25497084, 26184334, 26845719, 27607350, 31358969, 32814053, 33961781, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	3174636
GO:0005654	Component	Nucleoplasm	TAS
GO:0005689	Component	U12-type spliceosomal complex	IDA	15146077
GO:0005737	Component	Cytoplasm	IDA	24965446
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA	19029303
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	18809583
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0008544	Process	Epidermis development	ISS
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010494	Component	Cytoplasmic stress granule	IDA	18335541
GO:0017148	Process	Negative regulation of translation	ISS
GO:0035198	Function	MiRNA binding	IDA	27559612
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18809583
GO:0048255	Process	MRNA stabilization	IDA	31358969
GO:0048598	Process	Embryonic morphogenesis	ISS
GO:0050658	Process	RNA transport	IMP	29073095
GO:0051020	Function	GTPase binding	IPI	24337748
GO:0051031	Process	TRNA transport	IMP	29073095
GO:0051154	Process	Negative regulation of striated muscle cell differentiation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0062153	Function	C5-methylcytidine-containing RNA reader activity	IDA	31358969
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IDA	27559612, 28341602
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	19029303
GO:0070934	Process	CRD-mediated mRNA stabilization	IMP	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IDA	19029303
GO:0070937	Component	CRD-mediated mRNA stability complex	IPI	19029303
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	IEA
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	ISS
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	19029303
GO:1903608	Process	Protein localization to cytoplasmic stress granule	IMP	24965446
GO:1990428	Process	MiRNA transport	IDA	27559612
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	19029303
GO:2000773	Process	Negative regulation of cellular senescence	IEA
GO:2000773	Process	Negative regulation of cellular senescence	ISS

MIM	HGNC	e!Ensembl
154030	8014	ENSG00000065978

P67809

Protein name

Y-box-binding protein 1 (YB-1) (CCAAT-binding transcription factor I subunit A) (CBF-A) (DNA-binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI-A) (Nuclease-sensitive element-binding protein 1) (Y-box transcription factor)

Protein function

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation (PubMed:10817758, PubMed:11698476, PubMed:14718551, PubMed:18809583, PubMed:3

PDB

1H95 , 5YTS , 5YTT , 5YTV , 5YTX , 6A6L , 6KTC , 6KUG , 6LMR , 6LMS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00313	CSD	59 → 128		Domain

Sequence

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE

Sequence length

324

Interactions

View interactions

	Reactome
			mRNA Splicing - Major Pathway mRNA Splicing - Minor Pathway Noncanonical activation of NOTCH3

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
YBX1-related disorder	Likely benign; Benign	rs536995048, rs1190872059, rs148020196	RCV003912060 RCV003927048 RCV003971724

Show/Hide Text Mining Associations (113)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	27463019
Acute Kidney Injury	Associate	37058032
Adenocarcinoma	Associate	31180040, 33934437
Adenocarcinoma of Lung	Associate	33021972, 33144579
Amyotrophic Lateral Sclerosis	Associate	31936368
Arrest of spermatogenesis	Associate	33375868
Ataxia Telangiectasia	Associate	28009354
Atherosclerosis	Associate	18800033
Brain Neoplasms	Associate	20398058
Breast Neoplasms	Associate	16651443, 17875215, 18307537, 18925950, 19098458, 20079629, 20649952, 20844753, 21392397, 21466612, 21695211, 21968648, 22118625, 23178914, 24260353 View all (12 more)
Breast Neoplasms	Stimulate	21423216, 24443788
Calcinosis Cutis	Associate	25965573
Carcinogenesis	Stimulate	21423216
Carcinogenesis	Associate	24774443, 26240386, 30286788, 37370092, 37907737
Carcinoma Hepatocellular	Associate	30637779, 31495785, 32955083, 34366628, 35318110, 35833147, 36524514, 37459535, 38238845, 38297025
Carcinoma Large Cell	Associate	16101161
Carcinoma Non Small Cell Lung	Associate	14738225, 16101161, 24774443, 27463019, 31560169, 37161388
Carcinoma Non Small Cell Lung	Stimulate	28400280
Carcinoma Ovarian Epithelial	Associate	23748175
Carcinoma Renal Cell	Stimulate	25877750
Carcinoma Renal Cell	Associate	30275756, 32814829
Carcinoma Squamous Cell	Stimulate	16101161
Carcinoma Squamous Cell	Associate	19648825, 28708785, 37500615
Carcinoma Transitional Cell	Associate	37058032
Cholangiocarcinoma	Associate	34509526
Chorea Gravidarum	Associate	34281280
Chromosome Aberrations	Associate	21423216
Clear cell metastatic renal cell carcinoma	Associate	32814829
Colonic Neoplasms	Associate	11369762, 22118625
Colorectal Neoplasms	Associate	16207476, 21170361, 22118625, 26318844, 28035913, 28077578, 30658502, 32985589, 35861369, 35904175, 37611648
Colorectal Neoplasms	Stimulate	25674237
Diabetes Mellitus Type 1	Associate	35650387
Diabetic Nephropathies	Stimulate	28115289
Disease Resistance	Associate	20856196
Drug Related Side Effects and Adverse Reactions	Associate	18307537
Drug Related Side Effects and Adverse Reactions	Inhibit	27044807
Edema	Associate	37058032
Endometrial Neoplasms	Associate	40058870
Esophageal Neoplasms	Associate	37328464
Esophageal Squamous Cell Carcinoma	Associate	27044807, 36717549
Fetal Growth Retardation	Inhibit	34281280
Fever	Stimulate	11369762
Glioblastoma	Associate	20398058, 26240386, 31358880, 37540752, 38254206
Glioma	Associate	26936129, 27713156, 30679904, 32047913
Glioma	Stimulate	37994157
Glomerulonephritis Membranous	Associate	36588134
Head and Neck Neoplasms	Associate	22095225
Hematologic Neoplasms	Associate	24443788
Hereditary Breast and Ovarian Cancer Syndrome	Associate	38003589
HIV Infections	Associate	26360636
HTLV I Infections	Associate	26360636
Hypoxia	Associate	26498684
Hypoxia Brain	Associate	26498684
Idiopathic Pulmonary Fibrosis	Associate	32596346
Inflammation	Associate	18800033, 31836803, 34281280, 34380509, 37058032
Kidney Diseases	Associate	28115289, 37058032
Leukemia Myeloid Acute	Associate	21881046, 25715404, 38069522
Liposarcoma	Inhibit	12168660
Liposarcoma Myxoid	Associate	12168660
Lung Neoplasms	Associate	20398058, 24774443, 28400280, 29669758, 33934437
Lung Neoplasms	Stimulate	24443788
Lymphangioleiomyomatosis	Associate	34312290
Lymphatic Metastasis	Associate	25674237
Lymphoma B Cell	Associate	21300134
Lymphoma Large B Cell Diffuse	Associate	33377748
Medulloblastoma	Associate	28440450, 32585856
Melanoma	Associate	10735498, 26498684, 27922666, 30356079
Multiple Myeloma	Associate	18006704
Nasopharyngeal Carcinoma	Associate	32281175, 34131399, 35260638
Nasopharyngeal Neoplasms	Associate	18978732
Necrosis	Stimulate	16571807
Necrosis	Associate	37058032
Neoplasm Metastasis	Associate	23748175, 25877750, 25965573, 27044807, 27168020, 28302118, 28400280, 30275756, 30679904, 32814829, 34281280, 37058032, 37370092
Neoplasms	Stimulate	12695516, 20491776
Neoplasms	Associate	14738225, 16101161, 16479255, 16571807, 18307537, 18377424, 18809583, 19648825, 20079629, 20398058, 20844753, 21392397, 21423216, 21576761, 21695211 View all (43 more)
Neoplasms	Inhibit	15702969, 17822788, 34440660
Neoplasms Cystic Mucinous and Serous	Associate	39289424
Neuroblastoma	Associate	25993060
Nevus Pigmented	Associate	10735498
Non alcoholic Fatty Liver Disease	Associate	38238845, 39748602
Oral Submucous Fibrosis	Associate	32340273
Osteoarthritis	Associate	34964696
Osteosarcoma	Associate	40216969
Ovarian Neoplasms	Associate	12458343, 17459055, 18307537, 23748175, 39289424
Pancreatic Neoplasms	Associate	35637952
Pre Eclampsia	Stimulate	34281280
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	28009354
Primary Ovarian Insufficiency	Associate	32112110
Prostatic Neoplasms	Associate	21987172, 25797255, 26314494, 31758038, 31989173, 33064355, 34696665, 35904175
Prostatic Neoplasms Castration Resistant	Associate	28691182, 39337362
Prostatic Neoplasms Castration Resistant	Stimulate	33064355
Radiation Injuries	Associate	37540752
Recombinant chromosome 8 syndrome	Associate	37540752
Rectal Neoplasms	Associate	25790262
Renal Insufficiency Chronic	Stimulate	28115289
Rhabdomyosarcoma Alveolar	Associate	18377424
Rhabdomyosarcoma Embryonal	Associate	18377424
Sarcoma	Associate	25965573
Sarcoma Synovial	Associate	18307537
Sick Sinus Syndrome	Stimulate	18925950
Smoke Inhalation Injury	Associate	35637952
Squamous Cell Carcinoma of Head and Neck	Associate	22095225, 32216017
Squamous Cell Carcinoma of Head and Neck	Stimulate	35260638
Stomach Neoplasms	Associate	23613305, 25402957, 25959498, 26805816, 30286788, 33054752, 35521747, 37929660, 38364962
Systemic Inflammatory Response Syndrome	Associate	32585856
Triple Negative Breast Neoplasms	Associate	19758440, 23593654, 27286449, 35989353
Triple Negative Breast Neoplasms	Stimulate	34440660
Tuberculosis Multidrug Resistant	Stimulate	11369762, 18809583
Tuberculosis Multidrug Resistant	Associate	23178914
Urethral Neoplasms	Associate	20491776, 21138866
Uterine Cervical Neoplasms	Associate	28708785
Uterine Cervicitis	Associate	28708785
Virus Diseases	Associate	23613305

YBX1 (Y-box binding protein 1)