NRTN (neurturin)

Gene

• Entrez ID: 4902
• Gene name: Neurturin
• Gene symbol: NRTN
• Synonyms (NCBI Gene): NTN
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine ki

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022949	hsa-miR-124-3p	Microarray	18668037

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS	8945474
GO:0001755	Process	Neural crest cell migration	IDA	15242795
GO:0005102	Function	Signaling receptor binding	TAS	10829012
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	9286710
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	9286710
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	10829012, 29414779, 31535977
GO:0008083	Function	Growth factor activity	IEA
GO:0021675	Process	Nerve development	IEA
GO:0030116	Function	Glial cell-derived neurotrophic factor receptor binding	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0031175	Process	Neuron projection development	IDA	15242795
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IDA	29414779, 31535977
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IEA
GO:1904399	Function	Heparan sulfate binding	IDA	29414779

Other IDs

• MIM: 602018
• HGNC: 8007
• e!Ensembl: ENSG00000171119

Protein

• UniProt ID: Q99748
• Protein name: Neurturin
• Protein function: Growth factor that supports the survival of sympathetic neurons in culture (PubMed:8945474). May regulate the development and maintenance of the CNS (PubMed:8945474). Involved in the development of the neural crest (PubMed:15242795). Might contr
• PDB: 5MR4, 5MR5, 5MR9, 5NMZ, 6GL7, 6Q2O, 6Q2R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00019	TGF_beta	102 → 196	Transforming growth factor beta like domain	Domain

• Sequence:

  MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRAL
  LQGAPDAMELRELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYA
  SDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAH
  SRYHTVHELSARECACV

• Sequence length: 197

Pathways

KEGG:

MAPK signaling pathway
PI3K-Akt signaling pathway

Reactome:

RAF/MAP kinase cascade
RET signaling

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
NRTN-related disorder	Uncertain significance; Likely benign	rs375707068, rs922519870	RCV003397016 RCV003946897

Associations from Text Mining
Disease Name	Relationship Type	References
Breast Neoplasms	Associate	39671698
Carcinoma Hepatocellular	Associate	37211171
Hirschsprung Disease	Associate	20459765
Inflammation	Associate	40133606
Liver Cirrhosis	Associate	39252214
Neoplasm Metastasis	Associate	39671698
Neoplasms	Associate	39671698
Pain	Associate	25358061
Parkinson Disease	Associate	32203581, 33935108