Gene Gene information from NCBI Gene database.
Entrez ID 4900
Gene name Neurogranin
Gene symbol NRGN
Synonyms (NCBI Gene)
RC3hng
Chromosome 11
Chromosome location 11q24.2
Summary Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The ex
miRNA miRNA information provided by mirtarbase database.
117
miRTarBase ID miRNA Experiments Reference
MIRT492851 hsa-miR-744-5p PAR-CLIP 23592263
MIRT492850 hsa-miR-665 PAR-CLIP 23592263
MIRT492849 hsa-miR-3940-3p PAR-CLIP 23592263
MIRT492848 hsa-miR-3141 PAR-CLIP 23592263
MIRT492847 hsa-miR-6840-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005516 Function Calmodulin binding IEA
GO:0005516 Function Calmodulin binding TAS 10075657
GO:0005547 Function Phosphatidylinositol-3,4,5-trisphosphate binding IEA
GO:0005829 Component Cytosol TAS
GO:0007165 Process Signal transduction TAS 10075657
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602350 8000 ENSG00000154146
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92686
Protein name Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)]
Protein function Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00612 IQ 27 47 IQ calmodulin-binding motif Motif
Tissue specificity TISSUE SPECIFICITY: In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease. {ECO:0000269|PubMed:9329454}.
Sequence
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG
PGGAGVARGGAGGGPSGD
Sequence length 78
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Long-term potentiation