Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4900
Gene name Gene Name - the full gene name approved by the HGNC.	Neurogranin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NRGN
Synonyms (NCBI Gene) Gene synonyms aliases	RC3, hng
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The ex

Show/Hide all(117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT492851	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT492850	hsa-miR-665	PAR-CLIP	23592263
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT492848	hsa-miR-3141	PAR-CLIP	23592263
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT492845	hsa-miR-663a	PAR-CLIP	23592263
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT492838	hsa-miR-3180	PAR-CLIP	23592263
MIRT492837	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492836	hsa-miR-3196	PAR-CLIP	23592263
MIRT492835	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT492833	hsa-miR-5698	PAR-CLIP	23592263
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT492828	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	26701625
MIRT492848	hsa-miR-3141	PAR-CLIP	26701625
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	26701625
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT492833	hsa-miR-5698	PAR-CLIP	26701625
MIRT492845	hsa-miR-663a	PAR-CLIP	26701625
MIRT492850	hsa-miR-665	PAR-CLIP	26701625
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	26701625
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	26701625
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT734000	hsa-miR-4262	Luciferase reporter assay, qRT-PCR, Western blotting	32543324
MIRT492851	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT492850	hsa-miR-665	PAR-CLIP	23592263
MIRT492849	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT492848	hsa-miR-3141	PAR-CLIP	23592263
MIRT492847	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT492846	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT492845	hsa-miR-663a	PAR-CLIP	23592263
MIRT492844	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT492843	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT492841	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT492842	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT492840	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT492839	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT492838	hsa-miR-3180	PAR-CLIP	23592263
MIRT492837	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT492836	hsa-miR-3196	PAR-CLIP	23592263
MIRT492835	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT492834	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT492833	hsa-miR-5698	PAR-CLIP	23592263
MIRT492832	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT492831	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT492830	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT492829	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT492828	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT1921275	hsa-miR-1908	CLIP-seq
MIRT1921276	hsa-miR-663	CLIP-seq
MIRT2056242	hsa-miR-122	CLIP-seq
MIRT2056243	hsa-miR-151-3p	CLIP-seq
MIRT2056244	hsa-miR-28-3p	CLIP-seq
MIRT2056245	hsa-miR-2909	CLIP-seq
MIRT2056246	hsa-miR-299-5p	CLIP-seq
MIRT2056247	hsa-miR-3144-5p	CLIP-seq
MIRT2056248	hsa-miR-3191	CLIP-seq
MIRT2056249	hsa-miR-342-5p	CLIP-seq
MIRT2056250	hsa-miR-3619-3p	CLIP-seq
MIRT2056251	hsa-miR-4418	CLIP-seq
MIRT2056252	hsa-miR-4463	CLIP-seq
MIRT2056253	hsa-miR-4499	CLIP-seq
MIRT2056254	hsa-miR-4651	CLIP-seq
MIRT2056255	hsa-miR-4652-5p	CLIP-seq
MIRT2056256	hsa-miR-4664-5p	CLIP-seq
MIRT2056257	hsa-miR-4704-3p	CLIP-seq
MIRT2056258	hsa-miR-4717-3p	CLIP-seq
MIRT2056259	hsa-miR-509-3-5p	CLIP-seq
MIRT2056260	hsa-miR-509-5p	CLIP-seq
MIRT2056261	hsa-miR-608	CLIP-seq
MIRT2284814	hsa-miR-1254	CLIP-seq
MIRT2284815	hsa-miR-1262	CLIP-seq
MIRT2056243	hsa-miR-151-3p	CLIP-seq
MIRT2056244	hsa-miR-28-3p	CLIP-seq
MIRT2284816	hsa-miR-3116	CLIP-seq
MIRT2284817	hsa-miR-3126-5p	CLIP-seq
MIRT2056247	hsa-miR-3144-5p	CLIP-seq
MIRT2284818	hsa-miR-3158-5p	CLIP-seq
MIRT2056248	hsa-miR-3191	CLIP-seq
MIRT2056250	hsa-miR-3619-3p	CLIP-seq
MIRT2284819	hsa-miR-4294	CLIP-seq
MIRT2056251	hsa-miR-4418	CLIP-seq
MIRT2284820	hsa-miR-4419a	CLIP-seq
MIRT2056252	hsa-miR-4463	CLIP-seq
MIRT2056253	hsa-miR-4499	CLIP-seq
MIRT2284821	hsa-miR-4510	CLIP-seq
MIRT2056255	hsa-miR-4652-5p	CLIP-seq
MIRT2284822	hsa-miR-4701-3p	CLIP-seq
MIRT2056257	hsa-miR-4704-3p	CLIP-seq
MIRT2284823	hsa-miR-4710	CLIP-seq
MIRT2056258	hsa-miR-4717-3p	CLIP-seq
MIRT2284824	hsa-miR-4763-5p	CLIP-seq
MIRT2056259	hsa-miR-509-3-5p	CLIP-seq
MIRT2056260	hsa-miR-509-5p	CLIP-seq
MIRT2284825	hsa-miR-596	CLIP-seq
MIRT2284826	hsa-miR-661	CLIP-seq
MIRT2391748	hsa-miR-4283	CLIP-seq
MIRT2391749	hsa-miR-4731-5p	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	TAS	10075657
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	10075657
GO:0007399	Process	Nervous system development	TAS	10075657
GO:0008306	Process	Associative learning	IEA
GO:0012510	Component	Trans-Golgi network transport vesicle membrane	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0044327	Component	Dendritic spine head	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0070300	Function	Phosphatidic acid binding	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA

MIM	HGNC	e!Ensembl
602350	8000	ENSG00000154146

Protein

UniProt ID

Q92686

Protein name

Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)]

Protein function

Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00612	IQ	27 → 47	IQ calmodulin-binding motif	Motif

Tissue specificity

TISSUE SPECIFICITY: In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease. {ECO:0000269|PubMed:9329454}.

Sequence

MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG
PGGAGVARGGAGGGPSGD

Sequence length

Interactions

View interactions

	Reactome
			Long-term potentiation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Stimulate	26826204, 27604409, 36142742
Alzheimer Disease	Associate	27321472, 29700597, 30342961, 30846386, 32568193, 33765432, 33924468, 35173266, 36142780, 39242539
Alzheimer Disease	Inhibit	32776690
Anemia Sickle Cell	Associate	33915030
Atrophy	Associate	35584575
Brain Diseases	Associate	30953482
Brain Injuries Traumatic	Stimulate	29717219
Cerebral Infarction	Associate	32785988
Cognition Disorders	Associate	27321472, 30419087, 32776690
Cognition Disorders	Inhibit	39242539
Cognitive Dysfunction	Stimulate	27321472
Cognitive Dysfunction	Inhibit	30372675
Cognitive Dysfunction	Associate	30419087, 39242539
Cystic Fibrosis	Associate	3805287
Frontotemporal Lobar Degeneration	Associate	39242539
Glioblastoma	Associate	20419098
Glioma	Associate	32543324
Infections	Associate	23721325
Inflammation	Inhibit	23721325
Inflammation	Associate	29703241, 32785988
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	1460022
Lupus Erythematosus Systemic	Associate	30685201
Neurodegenerative Diseases	Associate	30419087
Neuroinflammatory Diseases	Associate	29703241
Night blindness congenital stationary	Associate	36142742, 36142780
Retrograde Degeneration	Associate	27321472
Schizophrenia	Associate	22781169, 30953482
Trauma Nervous System	Associate	33915030

NRGN (neurogranin)