Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4889
Gene name Gene Name - the full gene name approved by the HGNC.	Neuropeptide Y receptor Y5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPY5R
Synonyms (NCBI Gene) Gene synonyms aliases	NPY5-R, NPYR5, NPYY5-R
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT1191810	hsa-miR-106a	CLIP-seq
MIRT1191811	hsa-miR-106b	CLIP-seq
MIRT1191812	hsa-miR-17	CLIP-seq
MIRT1191813	hsa-miR-20a	CLIP-seq
MIRT1191814	hsa-miR-20b	CLIP-seq
MIRT1191815	hsa-miR-3609	CLIP-seq
MIRT1191816	hsa-miR-4509	CLIP-seq
MIRT1191817	hsa-miR-4744	CLIP-seq
MIRT1191818	hsa-miR-4796-3p	CLIP-seq
MIRT1191819	hsa-miR-4799-5p	CLIP-seq
MIRT1191820	hsa-miR-519d	CLIP-seq
MIRT1191821	hsa-miR-548ah	CLIP-seq
MIRT1191822	hsa-miR-93	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IBA	21873635
GO:0001602	Function	Pancreatic polypeptide receptor activity	IBA	21873635
GO:0002675	Process	Positive regulation of acute inflammatory response	IEA
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	8824284
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	8824284
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007568	Process	Aging	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0016020	Component	Membrane	IBA	21873635
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045202	Component	Synapse	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0060112	Process	Generation of ovulation cycle rhythm	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

MIM	HGNC	e!Ensembl
602001	7958	ENSG00000164129

Protein

UniProt ID

Q15761

Protein name

Neuropeptide Y receptor type 5 (NPY5-R) (NPY-Y5 receptor) (NPYY5-R) (Y5 receptor)

Protein function

Receptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	58 → 425	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Brain; hypothalamus.

Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM

Sequence length

445

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	10849579

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Alcohol Withdrawal Seizures	Associate	18828811
Alcoholism	Associate	18828811
Autistic Disorder	Associate	15090072
Breast Neoplasms	Associate	35093384
Carcinoma Renal Cell	Associate	32788609
Diabetes Mellitus	Inhibit	22029806
Dyslipidemias	Associate	17426313, 20797317
Hypertension	Associate	19593212
Hypertrophy Left Ventricular	Associate	19593212
Hypoxia	Stimulate	35093384, 35484119
Neoplasms	Associate	24681953
Obesity	Associate	23900445
Seizures	Associate	18828811
Substance Withdrawal Syndrome	Associate	18828811

NPY5R (neuropeptide Y receptor Y5)