Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4887
Gene name	Neuropeptide Y receptor Y2
Gene symbol	NPY2R
Synonyms (NCBI Gene)	NPY2-R
Chromosome	4
Chromosome location	4q32.1

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT572391	hsa-miR-4803	PAR-CLIP	20371350
MIRT572390	hsa-miR-302f	PAR-CLIP	20371350
MIRT572391	hsa-miR-4803	PAR-CLIP	20371350
MIRT572390	hsa-miR-302f	PAR-CLIP	20371350
MIRT1191791	hsa-miR-1279	CLIP-seq
MIRT1191792	hsa-miR-1298	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191794	hsa-miR-2054	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT1191796	hsa-miR-3180-5p	CLIP-seq
MIRT1191797	hsa-miR-4270	CLIP-seq
MIRT1191798	hsa-miR-4441	CLIP-seq
MIRT1191799	hsa-miR-4517	CLIP-seq
MIRT1191800	hsa-miR-4699-3p	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT1191802	hsa-miR-4760-3p	CLIP-seq
MIRT1191803	hsa-miR-503	CLIP-seq
MIRT1191804	hsa-miR-520a-5p	CLIP-seq
MIRT1191805	hsa-miR-520d-5p	CLIP-seq
MIRT1191806	hsa-miR-524-5p	CLIP-seq
MIRT1191807	hsa-miR-525-5p	CLIP-seq
MIRT1191808	hsa-miR-582-5p	CLIP-seq
MIRT1191809	hsa-miR-600	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT1191801	hsa-miR-4714-3p	CLIP-seq
MIRT2055622	hsa-miR-145	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT2055623	hsa-miR-3161	CLIP-seq
MIRT2055624	hsa-miR-369-3p	CLIP-seq
MIRT2055625	hsa-miR-375	CLIP-seq
MIRT2055626	hsa-miR-3908	CLIP-seq
MIRT2055627	hsa-miR-4790-5p	CLIP-seq
MIRT2055628	hsa-miR-545	CLIP-seq
MIRT2055629	hsa-miR-944	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT2284507	hsa-miR-3074-5p	CLIP-seq
MIRT1191796	hsa-miR-3180-5p	CLIP-seq
MIRT2284508	hsa-miR-4659a-3p	CLIP-seq
MIRT2284509	hsa-miR-4659b-3p	CLIP-seq
MIRT2284510	hsa-miR-513a-3p	CLIP-seq
MIRT1191804	hsa-miR-520a-5p	CLIP-seq
MIRT1191807	hsa-miR-525-5p	CLIP-seq
MIRT2055629	hsa-miR-944	CLIP-seq
MIRT1191793	hsa-miR-203	CLIP-seq
MIRT1191795	hsa-miR-3064-3p	CLIP-seq
MIRT2439067	hsa-miR-1297	CLIP-seq
MIRT2439068	hsa-miR-26a	CLIP-seq
MIRT2439069	hsa-miR-26b	CLIP-seq
MIRT2439070	hsa-miR-4465	CLIP-seq
MIRT2284508	hsa-miR-4659a-3p	CLIP-seq
MIRT2284509	hsa-miR-4659b-3p	CLIP-seq
MIRT2439071	hsa-miR-578	CLIP-seq
MIRT2686516	hsa-miR-129-5p	CLIP-seq
MIRT2686517	hsa-miR-3616-5p	CLIP-seq
MIRT2686518	hsa-miR-3647-5p	CLIP-seq
MIRT2686519	hsa-miR-4670-3p	CLIP-seq
MIRT2686520	hsa-miR-573	CLIP-seq
MIRT2686521	hsa-miR-586	CLIP-seq
MIRT2686522	hsa-miR-653	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001601	Function	Peptide YY receptor activity	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	TAS	7559383
GO:0005246	Function	Calcium channel regulator activity	TAS	8132547
GO:0005515	Function	Protein binding	IPI	23597562, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7592910
GO:0005929	Component	Cilium	IDA	28154160
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	7559383
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007263	Process	Nitric oxide mediated signal transduction	IEA
GO:0007626	Process	Locomotory behavior	TAS	9692752
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0016020	Component	Membrane	IEA
GO:0031645	Process	Negative regulation of nervous system process	IEA
GO:0033603	Process	Positive regulation of dopamine secretion	IEA
GO:0038023	Function	Signaling receptor activity	TAS	1321422
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0046010	Process	Positive regulation of circadian sleep/wake cycle, non-REM sleep	IEA
GO:0050805	Process	Negative regulation of synaptic transmission	IEA
GO:0051048	Process	Negative regulation of secretion	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0090394	Process	Negative regulation of excitatory postsynaptic potential	IEA
GO:0097730	Component	Non-motile cilium	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099538	Process	Synaptic signaling via neuropeptide	IEA
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IEA
GO:2000252	Process	Negative regulation of feeding behavior	IEA

MIM	HGNC	e!Ensembl
162642	7957	ENSG00000185149

P49146

Protein name

Neuropeptide Y receptor type 2 (NPY2-R) (NPY-Y2 receptor) (Y2 receptor)

Protein function

Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.

PDB

7X9B , 7YON , 7YOO , 8K6N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	67 → 325	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: High levels in amygdala, corpus callosum, hippocampus and subthalamic nucleus. Also detectable in caudate nucleus, hypothalamus and substantia nigra.

Sequence

MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV

Sequence length

381

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alcoholism	Associate	18828811, 27584037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Associate	33531491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	34975900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cocaine Related Disorders	Associate	18828811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Associate	27584037	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Inhibit	22029806	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	22427569	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	19593212	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Associate	19593212	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	34975900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Menopause Premature	Associate	29432556	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	17235527, 20642810, 21818152, 26711810, 27584037, 33531491	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Substance Withdrawal Syndrome	Associate	18828811	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular System Injuries	Associate	34975900	★★★★★ ★☆☆☆☆ Found in Text Mining only

NPY2R (neuropeptide Y receptor Y2)