Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4880
Gene name Gene Name - the full gene name approved by the HGNC.	Natriuretic peptide C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPPC
Synonyms (NCBI Gene) Gene synonyms aliases	CNP, CNP2
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded p

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016398	hsa-miR-193b-3p	Microarray	20304954
MIRT527128	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT527127	hsa-miR-5680	PAR-CLIP	22012620
MIRT527126	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT527125	hsa-miR-4495	PAR-CLIP	22012620
MIRT527124	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT527123	hsa-miR-3148	PAR-CLIP	22012620
MIRT527128	hsa-miR-548e-5p	PAR-CLIP	22012620
MIRT527127	hsa-miR-5680	PAR-CLIP	22012620
MIRT527126	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT527125	hsa-miR-4495	PAR-CLIP	22012620
MIRT527124	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT527123	hsa-miR-3148	PAR-CLIP	22012620

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001549	Process	Cumulus cell differentiation	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	ISS
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	IEA
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	1672777, 16870210, 26980729
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	1660465
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	1660465
GO:0005615	Component	Extracellular space	IEA
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006182	Process	CGMP biosynthetic process	IEA
GO:0006457	Process	Protein folding	IDA	16870210
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030250	Function	Guanylate cyclase activator activity	IDA	1660465
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0032991	Component	Protein-containing complex	IDA	16870210
GO:0035483	Process	Gastric emptying	IEA
GO:0036293	Process	Response to decreased oxygen levels	IEA
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048599	Process	Oocyte development	IEA
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0051276	Process	Chromosome organization	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051427	Function	Hormone receptor binding	IBA
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0051447	Process	Negative regulation of meiotic cell cycle	IDA	20947764
GO:0051447	Process	Negative regulation of meiotic cell cycle	IEA
GO:0061939	Process	C-di-GMP signaling	IEA
GO:0071965	Process	Multicellular organismal locomotion	IEA
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0098868	Process	Bone growth	ISS
GO:1900194	Process	Negative regulation of oocyte maturation	IDA	20947764
GO:1900194	Process	Negative regulation of oocyte maturation	IEA
GO:1903537	Process	Meiotic cell cycle process involved in oocyte maturation	IEA
GO:1904588	Process	Cellular response to glycoprotein	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
600296	7941	ENSG00000163273

Protein

UniProt ID

P23582

Protein name

C-type natriuretic peptide [Cleaved into: CNP-22; CNP-29; CNP-53]

Protein function

[CNP-22]: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by s

PDB

1JDP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00212	ANP	96 → 126	Atrial natriuretic peptide	Family

Tissue specificity

TISSUE SPECIFICITY: [CNP-22]: In the kidney, predominantly expressed in the distal tubular cells (at protein level). {ECO:0000269|PubMed:9794555}.

Sequence

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
MSGLGC

Sequence length

126

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Hormone signaling Vascular smooth muscle contraction Fluid shear stress and atherosclerosis		Physiological factors

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Short Stature With Nonspecific Skeletal Abnormalities	short stature with nonspecific skeletal abnormalities 1	N/A	N/A	GenCC

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Achondroplasia	Associate	35710503
Acute Kidney Injury	Associate	36385130
Adamantinoma	Associate	28661490
Carcinoma Small Cell	Associate	28661490
Cardiovascular Diseases	Associate	37101178
Growth Disorders	Associate	23805197, 28661490, 32282051
Heart defects limb shortening	Associate	23805197
Heart Failure	Associate	37798313
HEM dysplasia	Associate	28661490
Hypertension	Associate	12452325
Hyperthyroidism	Associate	21815902
Inflammation	Inhibit	22421372
Isolated Systolic Hypertension	Associate	26224401
Marfan Syndrome	Associate	23805197
Musculoskeletal Abnormalities	Associate	28661490
Neoplasms	Associate	33371790
Obesity	Associate	36613584
Plaque Atherosclerotic	Associate	22421372
Short Stature Idiopathic Autosomal	Associate	33850126
Ventricular Dysfunction Left	Associate	25371308

NPPC (natriuretic peptide C)