Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4880
Gene name Gene Name - the full gene name approved by the HGNC.
Natriuretic peptide C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPPC
Synonyms (NCBI Gene) Gene synonyms aliases
CNP, CNP2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded p
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016398 hsa-miR-193b-3p Microarray 20304954
MIRT527128 hsa-miR-548e-5p PAR-CLIP 22012620
MIRT527127 hsa-miR-5680 PAR-CLIP 22012620
MIRT527126 hsa-miR-449b-3p PAR-CLIP 22012620
MIRT527125 hsa-miR-4495 PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification IEA
GO:0001525 Process Angiogenesis IEA
GO:0001541 Process Ovarian follicle development IEA
GO:0001549 Process Cumulus cell differentiation IEA
GO:0001666 Process Response to hypoxia IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600296 7941 ENSG00000163273
Protein
UniProt ID P23582
Protein name C-type natriuretic peptide [Cleaved into: CNP-22; CNP-29; CNP-53]
Protein function [CNP-22]: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by s
PDB 1JDP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00212 ANP 96 126 Atrial natriuretic peptide Family
Tissue specificity TISSUE SPECIFICITY: [CNP-22]: In the kidney, predominantly expressed in the distal tubular cells (at protein level). {ECO:0000269|PubMed:9794555}.
Sequence
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
MSGLGC
Sequence length 126
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cGMP-PKG signaling pathway
Hormone signaling
Vascular smooth muscle contraction
Fluid shear stress and atherosclerosis
  Physiological factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Short Stature With Nonspecific Skeletal Abnormalities short stature with nonspecific skeletal abnormalities 1 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achondroplasia Associate 35710503
Acute Kidney Injury Associate 36385130
Adamantinoma Associate 28661490
Carcinoma Small Cell Associate 28661490
Cardiovascular Diseases Associate 37101178
Growth Disorders Associate 23805197, 28661490, 32282051
Heart defects limb shortening Associate 23805197
Heart Failure Associate 37798313
HEM dysplasia Associate 28661490
Hypertension Associate 12452325