Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4879
Gene name Gene Name - the full gene name approved by the HGNC.	Natriuretic peptide B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPPB
Synonyms (NCBI Gene) Gene synonyms aliases	BNP, Iso-ANP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein`s biologic

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019803	hsa-miR-375	Microarray	20215506

Transcription factors

Show/Hide all(9)

Transcription factor	Regulation	Reference
GATA4	Unknown	15464586
NFKB1	Unknown	15837525
NKX2-5	Unknown	15837525
RELA	Unknown	15837525
SHOX	Activation	17881654
SHOX	Unknown	24421874
SHOX2	Unknown	24421874
TEF	Unknown	15837525
XBP1	Activation	20170659

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IBA
GO:0003161	Process	Cardiac conduction system development	NAS	26786210
GO:0005102	Function	Signaling receptor binding	IDA	1672777
GO:0005102	Function	Signaling receptor binding	IPI	12727915, 16870210
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	NAS	7601467
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	14960748
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	7601467
GO:0005737	Component	Cytoplasm	IBA
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006457	Process	Protein folding	IDA	16870210
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	12727915
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	TAS	14737067
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007589	Process	Body fluid secretion	TAS	14960748
GO:0008217	Process	Regulation of blood pressure	NAS	12727915
GO:0008613	Function	Diuretic hormone activity	TAS	14960748
GO:0016525	Process	Negative regulation of angiogenesis	TAS	14737067
GO:0019934	Process	CGMP-mediated signaling	IBA
GO:0030250	Function	Guanylate cyclase activator activity	TAS	14960748
GO:0030308	Process	Negative regulation of cell growth	NAS	12727915
GO:0031640	Process	Killing of cells of another organism	IDA	11410403
GO:0032991	Component	Protein-containing complex	IDA	16870210, 23382219
GO:0035810	Process	Positive regulation of urine volume	TAS	14737067
GO:0035815	Process	Positive regulation of renal sodium excretion	TAS	14960748
GO:0042311	Process	Vasodilation	IEA
GO:0043114	Process	Regulation of vascular permeability	IDA	36016499
GO:0043114	Process	Regulation of vascular permeability	TAS	14737067
GO:0051427	Function	Hormone receptor binding	IBA
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	11410403
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	NAS	7601467

MIM	HGNC	e!Ensembl
600295	7940	ENSG00000120937

Protein

UniProt ID

P16860

Protein name

Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain

Protein function

[Brain natriuretic peptide 32]: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By

PDB

1YK1 , 3N56

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00212	ANP	98 → 128	Atrial natriuretic peptide	Family

Tissue specificity

TISSUE SPECIFICITY: [Brain natriuretic peptide 32]: Detected in the cardiac atria (at protein level) (PubMed:2136732, PubMed:2138890). Detected in the kidney distal tubular cells (at protein level) (PubMed:9794555). {ECO:0000269|PubMed:2136732, ECO:000026

Sequence

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
SSSSGLGCKVLRRH

Sequence length

134

Interactions

View interactions

	KEGG
	cGMP-PKG signaling pathway Hormone signaling Vascular smooth muscle contraction Thermogenesis

NPPB (natriuretic peptide B)