NPPB (natriuretic peptide B)

Gene

• Entrez ID: 4879
• Gene name: Natriuretic peptide B
• Gene symbol: NPPB
• Synonyms (NCBI Gene): BNP, Iso-ANP
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein`s biologic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019803	hsa-miR-375	Microarray	20215506

Transcription factors

Transcription factor	Regulation	Reference
GATA4	Unknown	15464586
NFKB1	Unknown	15837525
NKX2-5	Unknown	15837525
RELA	Unknown	15837525
SHOX	Activation	17881654
SHOX	Unknown	24421874
SHOX2	Unknown	24421874
TEF	Unknown	15837525
XBP1	Activation	20170659

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003008	Process	System process	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IBA
GO:0003161	Process	Cardiac conduction system development	NAS	26786210
GO:0005102	Function	Signaling receptor binding	IDA	1672777
GO:0005102	Function	Signaling receptor binding	IPI	12727915, 16870210
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	NAS	7601467
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	14960748
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	7601467
GO:0005737	Component	Cytoplasm	IBA
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006457	Process	Protein folding	IDA	16870210
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	12727915
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	TAS	14737067
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007589	Process	Body fluid secretion	TAS	14960748
GO:0008217	Process	Regulation of blood pressure	NAS	12727915
GO:0008613	Function	Diuretic hormone activity	TAS	14960748
GO:0016525	Process	Negative regulation of angiogenesis	TAS	14737067
GO:0019934	Process	CGMP-mediated signaling	IBA
GO:0030250	Function	Guanylate cyclase activator activity	TAS	14960748
GO:0030308	Process	Negative regulation of cell growth	NAS	12727915
GO:0031640	Process	Killing of cells of another organism	IDA	11410403
GO:0032991	Component	Protein-containing complex	IDA	16870210, 23382219
GO:0035810	Process	Positive regulation of urine volume	TAS	14737067
GO:0035815	Process	Positive regulation of renal sodium excretion	TAS	14960748
GO:0042311	Process	Vasodilation	IEA
GO:0043114	Process	Regulation of vascular permeability	IDA	36016499
GO:0043114	Process	Regulation of vascular permeability	TAS	14737067
GO:0051427	Function	Hormone receptor binding	IBA
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	11410403
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	NAS	7601467

Other IDs

• MIM: 600295
• HGNC: 7940
• e!Ensembl: ENSG00000120937

Protein

• UniProt ID: P16860
• Protein name: Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain
• Protein function: [Brain natriuretic peptide 32]: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By
• PDB: 1YK1, 3N56
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00212	ANP	98 → 128	Atrial natriuretic peptide	Family

• Tissue specificity: TISSUE SPECIFICITY: [Brain natriuretic peptide 32]: Detected in the cardiac atria (at protein level) (PubMed:2136732, PubMed:2138890). Detected in the kidney distal tubular cells (at protein level) (PubMed:9794555). {ECO:0000269|PubMed:2136732, ECO:000026
• Sequence:

  MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE
  QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI
  SSSSGLGCKVLRRH

• Sequence length: 134

Pathways

KEGG:

cGMP-PKG signaling pathway
Hormone signaling
Vascular smooth muscle contraction
Thermogenesis