Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4869
Gene name	Nucleophosmin 1
Gene symbol	NPM1
Synonyms (NCBI Gene)	B23NPM
Chromosome	5
Chromosome location	5q35.1
Summary	The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribos

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587776806	->TCTG	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant, genic downstream transcript variant
rs1057519744	->CATG,CCTG,TCAG,TCTG	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant, non coding transcript variant
rs1554138188	->CATG,CGTG	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, genic downstream transcript variant
rs1554138189	->CCTG	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, genic downstream transcript variant
rs1561878500	GGAGGAA>CCCTGGCTAGG	Pathogenic	Genic downstream transcript variant, frameshift variant, non coding transcript variant, coding sequence variant
rs1581263026	GCAGTGGAGG>TTTAAGGATTCGTC	Pathogenic	Frameshift variant, genic downstream transcript variant, coding sequence variant, non coding transcript variant

258

Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050209	hsa-miR-25-3p	CLASH	23622248
MIRT049162	hsa-miR-92a-3p	CLASH	23622248
MIRT049162	hsa-miR-92a-3p	CLASH	23622248
MIRT048875	hsa-miR-93-5p	CLASH	23622248
MIRT046385	hsa-miR-15b-5p	CLASH	23622248
MIRT046377	hsa-miR-23b-3p	CLASH	23622248
MIRT045923	hsa-miR-125b-5p	CLASH	23622248
MIRT045754	hsa-miR-125a-5p	CLASH	23622248
MIRT045680	hsa-miR-149-5p	CLASH	23622248
MIRT044729	hsa-miR-320a	CLASH	23622248
MIRT041488	hsa-miR-193b-3p	CLASH	23622248
MIRT040565	hsa-miR-92b-3p	CLASH	23622248
MIRT040565	hsa-miR-92b-3p	CLASH	23622248
MIRT040495	hsa-miR-598-3p	CLASH	23622248
MIRT039598	hsa-miR-625-5p	CLASH	23622248
MIRT039386	hsa-miR-421	CLASH	23622248
MIRT038792	hsa-miR-93-3p	CLASH	23622248
MIRT038406	hsa-miR-296-3p	CLASH	23622248
MIRT215234	hsa-miR-4428	PAR-CLIP	21572407
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT215233	hsa-miR-646	PAR-CLIP	21572407
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT358339	hsa-miR-4461	PAR-CLIP	21572407
MIRT215235	hsa-miR-4521	PAR-CLIP	21572407
MIRT503913	hsa-miR-4468	PAR-CLIP	21572407
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT312879	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT503912	hsa-miR-3671	PAR-CLIP	21572407
MIRT503911	hsa-miR-607	PAR-CLIP	21572407
MIRT312881	hsa-miR-4484	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522216	hsa-miR-586	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312883	hsa-miR-8053	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT503911	hsa-miR-607	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT503911	hsa-miR-607	PAR-CLIP	23446348
MIRT358337	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT472025	hsa-miR-8087	PAR-CLIP	23592263
MIRT472026	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT472024	hsa-miR-2115-3p	PAR-CLIP	23592263
MIRT358370	hsa-miR-5186	PAR-CLIP	23592263
MIRT358338	hsa-miR-4450	PAR-CLIP	23592263
MIRT215234	hsa-miR-4428	PAR-CLIP	21572407
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	21572407
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	21572407
MIRT215233	hsa-miR-646	PAR-CLIP	21572407
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT358339	hsa-miR-4461	PAR-CLIP	21572407
MIRT215235	hsa-miR-4521	PAR-CLIP	21572407
MIRT503913	hsa-miR-4468	PAR-CLIP	21572407
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT312879	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT503912	hsa-miR-3671	PAR-CLIP	21572407
MIRT503911	hsa-miR-607	PAR-CLIP	21572407
MIRT312881	hsa-miR-4484	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT522216	hsa-miR-586	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312883	hsa-miR-8053	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT503911	hsa-miR-607	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT215234	hsa-miR-4428	PAR-CLIP	23446348
MIRT503915	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT503914	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT215233	hsa-miR-646	PAR-CLIP	23446348
MIRT215237	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT358339	hsa-miR-4461	PAR-CLIP	23446348
MIRT215235	hsa-miR-4521	PAR-CLIP	23446348
MIRT503913	hsa-miR-4468	PAR-CLIP	23446348
MIRT312880	hsa-miR-520d-5p	PAR-CLIP	23446348
MIRT312879	hsa-miR-524-5p	PAR-CLIP	23446348
MIRT503912	hsa-miR-3671	PAR-CLIP	23446348
MIRT503911	hsa-miR-607	PAR-CLIP	23446348
MIRT358337	hsa-miR-3121-3p	PAR-CLIP	23592263
MIRT472025	hsa-miR-8087	PAR-CLIP	23592263
MIRT472026	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT472024	hsa-miR-2115-3p	PAR-CLIP	23592263
MIRT358370	hsa-miR-5186	PAR-CLIP	23592263
MIRT358338	hsa-miR-4450	PAR-CLIP	23592263
MIRT1191017	hsa-miR-1229	CLIP-seq
MIRT1191018	hsa-miR-182	CLIP-seq
MIRT1191019	hsa-miR-200b	CLIP-seq
MIRT1191020	hsa-miR-200c	CLIP-seq
MIRT1191021	hsa-miR-208a	CLIP-seq
MIRT1191022	hsa-miR-208b	CLIP-seq
MIRT1191023	hsa-miR-23a	CLIP-seq
MIRT1191024	hsa-miR-23b	CLIP-seq
MIRT1191025	hsa-miR-23c	CLIP-seq
MIRT1191026	hsa-miR-3143	CLIP-seq
MIRT1191027	hsa-miR-3153	CLIP-seq
MIRT1191028	hsa-miR-3163	CLIP-seq
MIRT1191029	hsa-miR-340	CLIP-seq
MIRT1191030	hsa-miR-3646	CLIP-seq
MIRT1191031	hsa-miR-3647-3p	CLIP-seq
MIRT1191032	hsa-miR-3690	CLIP-seq
MIRT1191033	hsa-miR-4256	CLIP-seq
MIRT1191034	hsa-miR-4282	CLIP-seq
MIRT1191035	hsa-miR-4286	CLIP-seq
MIRT1191036	hsa-miR-429	CLIP-seq
MIRT1191037	hsa-miR-4477a	CLIP-seq
MIRT1191038	hsa-miR-4520a-3p	CLIP-seq
MIRT1191039	hsa-miR-4520b-3p	CLIP-seq
MIRT1191040	hsa-miR-4528	CLIP-seq
MIRT1191041	hsa-miR-4529-3p	CLIP-seq
MIRT1191042	hsa-miR-4638-3p	CLIP-seq
MIRT1191043	hsa-miR-4639-3p	CLIP-seq
MIRT1191044	hsa-miR-4682	CLIP-seq
MIRT1191045	hsa-miR-4716-5p	CLIP-seq
MIRT1191046	hsa-miR-4717-3p	CLIP-seq
MIRT1191047	hsa-miR-4729	CLIP-seq
MIRT1191048	hsa-miR-487a	CLIP-seq
MIRT1191049	hsa-miR-490-3p	CLIP-seq
MIRT1191050	hsa-miR-495	CLIP-seq
MIRT1191051	hsa-miR-543	CLIP-seq
MIRT1191052	hsa-miR-548ac	CLIP-seq
MIRT1191053	hsa-miR-548ae	CLIP-seq
MIRT1191054	hsa-miR-548aj	CLIP-seq
MIRT1191055	hsa-miR-548am	CLIP-seq
MIRT1191056	hsa-miR-548d-3p	CLIP-seq
MIRT1191057	hsa-miR-548x	CLIP-seq
MIRT1191058	hsa-miR-548z	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT1191060	hsa-miR-619	CLIP-seq
MIRT1191061	hsa-miR-654-3p	CLIP-seq
MIRT1191062	hsa-miR-676	CLIP-seq
MIRT1191028	hsa-miR-3163	CLIP-seq
MIRT1191029	hsa-miR-340	CLIP-seq
MIRT1191040	hsa-miR-4528	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT2055340	hsa-miR-142-3p	CLIP-seq
MIRT2055341	hsa-miR-1587	CLIP-seq
MIRT2055342	hsa-miR-3117-5p	CLIP-seq
MIRT2055343	hsa-miR-371-3p	CLIP-seq
MIRT2055344	hsa-miR-371b-3p	CLIP-seq
MIRT2055345	hsa-miR-4666-5p	CLIP-seq
MIRT2055346	hsa-miR-4674	CLIP-seq
MIRT2055347	hsa-miR-4713-5p	CLIP-seq
MIRT2055348	hsa-miR-4775	CLIP-seq
MIRT2055349	hsa-miR-4797-3p	CLIP-seq
MIRT2055350	hsa-miR-515-3p	CLIP-seq
MIRT2055351	hsa-miR-519e	CLIP-seq
MIRT2055352	hsa-miR-593	CLIP-seq
MIRT2055353	hsa-miR-9	CLIP-seq
MIRT2055340	hsa-miR-142-3p	CLIP-seq
MIRT2055341	hsa-miR-1587	CLIP-seq
MIRT2055342	hsa-miR-3117-5p	CLIP-seq
MIRT2055343	hsa-miR-371-3p	CLIP-seq
MIRT2055344	hsa-miR-371b-3p	CLIP-seq
MIRT2055345	hsa-miR-4666-5p	CLIP-seq
MIRT2055346	hsa-miR-4674	CLIP-seq
MIRT2055347	hsa-miR-4713-5p	CLIP-seq
MIRT2055348	hsa-miR-4775	CLIP-seq
MIRT2055349	hsa-miR-4797-3p	CLIP-seq
MIRT2055350	hsa-miR-515-3p	CLIP-seq
MIRT2055351	hsa-miR-519e	CLIP-seq
MIRT2055352	hsa-miR-593	CLIP-seq
MIRT2055353	hsa-miR-9	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT1191017	hsa-miR-1229	CLIP-seq
MIRT1191018	hsa-miR-182	CLIP-seq
MIRT1191027	hsa-miR-3153	CLIP-seq
MIRT1191028	hsa-miR-3163	CLIP-seq
MIRT1191029	hsa-miR-340	CLIP-seq
MIRT1191032	hsa-miR-3690	CLIP-seq
MIRT1191033	hsa-miR-4256	CLIP-seq
MIRT1191035	hsa-miR-4286	CLIP-seq
MIRT1191038	hsa-miR-4520a-3p	CLIP-seq
MIRT1191039	hsa-miR-4520b-3p	CLIP-seq
MIRT1191040	hsa-miR-4528	CLIP-seq
MIRT1191041	hsa-miR-4529-3p	CLIP-seq
MIRT1191042	hsa-miR-4638-3p	CLIP-seq
MIRT1191043	hsa-miR-4639-3p	CLIP-seq
MIRT1191045	hsa-miR-4716-5p	CLIP-seq
MIRT1191049	hsa-miR-490-3p	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT1191060	hsa-miR-619	CLIP-seq
MIRT1191061	hsa-miR-654-3p	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT1191059	hsa-miR-587	CLIP-seq
MIRT2055340	hsa-miR-142-3p	CLIP-seq
MIRT2055341	hsa-miR-1587	CLIP-seq
MIRT2055342	hsa-miR-3117-5p	CLIP-seq
MIRT2055343	hsa-miR-371-3p	CLIP-seq
MIRT2055344	hsa-miR-371b-3p	CLIP-seq
MIRT2055345	hsa-miR-4666-5p	CLIP-seq
MIRT2055346	hsa-miR-4674	CLIP-seq
MIRT2055347	hsa-miR-4713-5p	CLIP-seq
MIRT2055348	hsa-miR-4775	CLIP-seq
MIRT2055349	hsa-miR-4797-3p	CLIP-seq
MIRT2055350	hsa-miR-515-3p	CLIP-seq
MIRT2055351	hsa-miR-519e	CLIP-seq
MIRT2055352	hsa-miR-593	CLIP-seq
MIRT2055353	hsa-miR-9	CLIP-seq
MIRT2055340	hsa-miR-142-3p	CLIP-seq
MIRT2055341	hsa-miR-1587	CLIP-seq
MIRT2055342	hsa-miR-3117-5p	CLIP-seq
MIRT2055343	hsa-miR-371-3p	CLIP-seq
MIRT2055344	hsa-miR-371b-3p	CLIP-seq
MIRT2055345	hsa-miR-4666-5p	CLIP-seq
MIRT2055346	hsa-miR-4674	CLIP-seq
MIRT2055347	hsa-miR-4713-5p	CLIP-seq
MIRT2055348	hsa-miR-4775	CLIP-seq
MIRT2055349	hsa-miR-4797-3p	CLIP-seq
MIRT2055350	hsa-miR-515-3p	CLIP-seq
MIRT2055351	hsa-miR-519e	CLIP-seq
MIRT2055352	hsa-miR-593	CLIP-seq
MIRT2055353	hsa-miR-9	CLIP-seq

123

Show/Hide all (123)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000055	Process	Ribosomal large subunit export from nucleus	IBA
GO:0000055	Process	Ribosomal large subunit export from nucleus	IEA
GO:0000056	Process	Ribosomal small subunit export from nucleus	IBA
GO:0000056	Process	Ribosomal small subunit export from nucleus	IEA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	19160485
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001652	Component	Granular component	IEA
GO:0001652	Component	Granular component	TAS
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	15087454, 19160485
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	12058066
GO:0003723	Function	RNA binding	IEA
GO:0004860	Function	Protein kinase inhibitor activity	IDA	12882984
GO:0005515	Function	Protein binding	IPI	12080348, 12882984, 15144954, 15161933, 15184379, 15989956, 16376884, 16540653, 16648475, 16957780, 17015463, 17318229, 17438371, 17475909, 17535915, 17602943, 18243139, 18259216, 18420587, 19160485, 19188445, 19410545, 20075868, 20080577, 20159986, 20208519, 20618440, 20701745, 213
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	38231884
GO:0005634	Component	Nucleus	IDA	12080348, 22720776
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA	12058066, 19160485
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	11420665, 12080348, 16041368, 17475909, 18809582, 19160485, 19188445, 19208757, 22528486, 25956029
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9121481
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	11051553
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006281	Process	DNA repair	IDA	19188445
GO:0006334	Process	Nucleosome assembly	IDA	11602260
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006606	Process	Protein import into nucleus	IDA	38231884
GO:0006884	Process	Cell volume homeostasis	IEA
GO:0006886	Process	Intracellular protein transport	TAS	12080348
GO:0006913	Process	Nucleocytoplasmic transport	IDA	16041368
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	TAS	12080348
GO:0007098	Process	Centrosome cycle	IMP	11051553
GO:0007165	Process	Signal transduction	NAS	16130169
GO:0008104	Process	Intracellular protein localization	IDA	18420587
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	22528486
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	12080348
GO:0009891	Process	Positive regulation of biosynthetic process	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010824	Process	Regulation of centrosome duplication	IBA
GO:0010824	Process	Regulation of centrosome duplication	IEA
GO:0010825	Process	Positive regulation of centrosome duplication	IEA
GO:0010826	Process	Negative regulation of centrosome duplication	IMP	16041368
GO:0015934	Component	Large ribosomal subunit	IEA
GO:0015935	Component	Small ribosomal subunit	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IEA
GO:0019843	Function	RRNA binding	IEA
GO:0019843	Function	RRNA binding	IPI	24106084
GO:0019901	Function	Protein kinase binding	IPI	20352051
GO:0030225	Process	Macrophage differentiation	IDA	38231884
GO:0030225	Process	Macrophage differentiation	IDA	38231884
GO:0030957	Function	Tat protein binding	IDA	9094689
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031616	Component	Spindle pole centrosome	IDA	16041368
GO:0031647	Process	Regulation of protein stability	IEA
GO:0032071	Process	Regulation of endodeoxyribonuclease activity	IDA	19188445
GO:0032991	Component	Protein-containing complex	IDA	19160485
GO:0032993	Component	Protein-DNA complex	IDA	19160485
GO:0034644	Process	Cellular response to UV	IDA	19160485
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042255	Process	Ribosome assembly	TAS	12080348
GO:0042273	Process	Ribosomal large subunit biogenesis	IBA
GO:0042273	Process	Ribosomal large subunit biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IBA
GO:0042274	Process	Ribosomal small subunit biogenesis	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	11602260
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	9121481
GO:0042803	Function	Protein homodimerization activity	IPI	24106084
GO:0043023	Function	Ribosomal large subunit binding	IDA	18809582
GO:0043024	Function	Ribosomal small subunit binding	IDA	18809582
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12882984
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	16130169
GO:0043516	Process	Regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0044387	Process	Negative regulation of protein kinase activity by regulation of protein phosphorylation	IDA	12882984
GO:0045727	Process	Positive regulation of translation	IDA	12882984
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	22528486
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160485
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	25956029
GO:0046599	Process	Regulation of centriole replication	IMP	20352051
GO:0048025	Process	Negative regulation of mRNA splicing, via spliceosome	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051059	Function	NF-kappaB binding	IDA	15087454
GO:0051082	Function	Unfolded protein binding	IDA	10211837
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	15087454
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	38231884
GO:0060699	Process	Regulation of endoribonuclease activity	IDA	19188445
GO:0060735	Process	Regulation of eIF2 alpha phosphorylation by dsRNA	IDA	12882984
GO:0090398	Process	Cellular senescence	IMP	12080348
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19160485
GO:1902629	Process	Regulation of mRNA stability involved in cellular response to UV	IMP	12080348
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IDA	22528486
GO:1904751	Process	Positive regulation of protein localization to nucleolus	IEA
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	18809582

MIM	HGNC	e!Ensembl
164040	7910	ENSG00000181163

P06748

Protein name

Nucleophosmin (NPM) (Nucleolar phosphoprotein B23) (Nucleolar protein NO38) (Numatrin)

Protein function

Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribos

PDB

2LLH , 2P1B , 2VXD , 5EHD , 7OBG , 7OBH , 8AH2 , 8AS5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03066	Nucleoplasmin	18 → 117	Nucleoplasmin/nucleophosmin domain	Domain
PF16276	NPM1-C	245 → 293	Nucleophosmin C-terminal domain	Domain

Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Sequence length

294

Interactions

View interactions

	Reactome
			Nuclear import of Rev protein SUMOylation of transcription cofactors Deposition of new CENPA-containing nucleosomes at the centromere TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Acute myeloid leukemia	Pathogenic	rs2113301391, rs2113301331, rs587776806, rs1554138188, rs1554138189, rs1561878500	RCV002277721 RCV002277742 RCV000015035 RCV000015036 RCV000015037 RCV000015038 RCV000779592
Acute myeloid leukemia with multilineage dysplasia	Pathogenic	rs1581263026	RCV000999466
Acute myeloid leukemia with NPM1 somatic mutations	Pathogenic	rs1554138189	RCV006253623
Myelodysplastic syndrome progressed to acute myeloid leukemia	Pathogenic	rs587776806	RCV000203461
NPM1-related disorder	Pathogenic	rs587776806	RCV004754261

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cholangiocarcinoma	Benign	rs60056043	RCV005921949
Colon adenocarcinoma	Benign	rs34323200	RCV005871414
Familial cancer of breast	Benign	rs60056043	RCV005921945
Gastric cancer	Benign	rs34323200	RCV005871415
Hepatocellular carcinoma	Benign	rs6555953	RCV005923769
Nonpapillary renal cell carcinoma	Benign	rs60056043	RCV005921946
Ovarian cancer	Benign	rs60056043	RCV005921947
Uterine carcinosarcoma	Benign	rs60056043	RCV005921948

Show/Hide Text Mining Associations (127)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	26315110, 32671956
Adenocarcinoma of Lung	Associate	32671956, 34335635
Adrenocortical Carcinoma	Associate	36793283
Alzheimer Disease	Associate	26512942
Anemia	Associate	36959701
Aneuploidy	Associate	26123729
Arthritis Rheumatoid	Inhibit	15589822
Ascites	Associate	35208587
Asthma	Associate	35751199
Ataxia Telangiectasia	Associate	16170336
Autoimmune Diseases	Associate	25779011
Blast Injuries	Associate	25615838
Bone Marrow Diseases	Associate	35185048
Breast Neoplasms	Associate	21689627, 21738817, 23062075, 32236595, 34327780
Carcinogenesis	Stimulate	16170336, 27959455
Carcinogenesis	Associate	16766651, 17245342, 18480108, 19581289, 21204709, 24410879, 25490769
Carcinoma Hepatocellular	Stimulate	17245342
Carcinoma Hepatocellular	Associate	25490769, 25779011, 26536659, 27831650, 28596685, 28874807, 38097352
Carcinoma Non Small Cell Lung	Associate	33358698
Carcinoma Pancreatic Ductal	Associate	35142956
Carcinoma Renal Cell	Associate	37515929
Carcinoma Squamous Cell	Associate	18480108, 36780540
Cell Transformation Neoplastic	Associate	26205693
Cell Transformation Viral	Associate	28740552
Chromosome Aberrations	Associate	29360622, 31430225, 36823396, 38165072
Colonic Neoplasms	Associate	34201061
Colorectal Neoplasms	Associate	20027629, 22631075, 24716928, 28675510, 34201061, 34639107
Coronary Artery Disease	Associate	31881747
Death	Associate	21372155, 25113226, 26789727, 34162404
Disease	Associate	20981679, 26789727
Drug Related Side Effects and Adverse Reactions	Associate	30981631, 31307523
Drug Related Side Effects and Adverse Reactions	Stimulate	31250621
Dykes Markes Harper syndrome	Associate	24288427
Encephalitis Tick Borne	Associate	33879827, 36753372
Endometrial Neoplasms	Associate	37610103
Esophageal Squamous Cell Carcinoma	Associate	36942988
Fanconi Anemia	Associate	12882984
Gallbladder Neoplasms	Associate	37142981
Gastritis	Associate	24410879
Genetic Diseases Inborn	Associate	16455956, 18268276, 39711284
Genetic Predisposition to Disease	Associate	20858903, 38126102
Glioblastoma	Associate	26108672, 38286983
Heart Diseases	Associate	38273254
Hematologic Diseases	Associate	20981679, 21689627, 36959701
Hematologic Neoplasms	Inhibit	23065518
Hematologic Neoplasms	Associate	30577887, 35621629
Hemophilia B	Associate	35185048
Hereditary renal agenesis	Associate	24816240
Hodgkin Disease	Associate	34164626, 7742546, 8701985
Hypertension Pulmonary	Associate	14730621
Hypoxia	Stimulate	15310764
Hypoxia	Associate	34335635, 34388291
Hypoxia Brain	Associate	15310764
Inflammation	Stimulate	36834892
Inflammation	Associate	37470778
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	16109776
Laryngeal Neoplasms	Associate	31152622
Leukemia	Associate	15589822, 15870172, 16645213, 16720834, 18175937, 18403613, 18450602, 18603563, 20015883, 20060365, 20538791, 20858903, 20864535, 20877721, 21537492 View all (39 more)
Leukemia Basophilic Acute	Associate	34132463
Leukemia Lymphocytic Chronic B Cell	Associate	14557598, 28321119, 36282861
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16704439, 25961029, 26205693
Leukemia Myeloid	Associate	16597596, 37427790
Leukemia Myeloid Acute	Associate	15659725, 15870172, 15994285, 16046528, 16051734, 16076867, 16109776, 16455956, 16645213, 16720834, 16926285, 17440048, 17768124, 17957027, 18175937 View all (338 more)
Leukemia Myelomonocytic Chronic	Associate	16704439, 18055864
Leukemia Promyelocytic Acute	Associate	10753851, 19291801, 25033841, 26997274, 29274134, 30876657, 30996344, 32755558, 33301193, 34459465, 9256429
Leukemia T Cell	Associate	19067680, 22712502, 23742937
Leukemic Infiltration	Associate	26884713
Leukopenia	Associate	36959701
Liver Cirrhosis	Associate	17245342
Lung Neoplasms	Associate	17069796
Lupus Erythematosus Systemic	Associate	25779011
Lymphatic Metastasis	Associate	22631075
Lymphoma	Associate	20877721, 28659337, 32573700, 33246076, 33514657
Lymphoma B Cell	Associate	20207848
Lymphoma Large B Cell Diffuse	Associate	9094977
Lymphoma Large Cell Anaplastic	Associate	10339500, 10381534, 10556217, 11215285, 12213716, 15374880, 15588951, 15928040, 15972965, 16651537, 17464320, 17706593, 18070884, 19286999, 19531656 View all (20 more)
Lymphoma Mantle Cell	Associate	18625744
Lymphoma Non Hodgkin	Associate	16123598
Lymphoma Primary Effusion	Associate	20333249
Lymphoma T Cell	Associate	16766651, 19088198, 24218456, 26476082, 28005077, 35640677, 37773266
Lymphoproliferative Disorders	Associate	25349176
Mastocytosis Systemic	Associate	28424161
Mesothelioma Malignant	Associate	32671956
Mouth Neoplasms	Associate	19581289, 36674758, 9736036
Myelodysplastic Myeloproliferative Diseases	Associate	20421268, 30902805
Myelodysplastic Syndromes	Associate	19279329, 19569249, 20678218, 20877721, 21789382, 24850867, 27992414, 30417521, 30902805, 31085507, 34111285, 36959701, 39390137, 39711284
Myeloproliferative Disorders	Associate	22348345
Myotonic Dystrophy	Associate	26847745
Neoplasm Metastasis	Stimulate	18416831, 24358147
Neoplasm Metastasis	Associate	26536659, 37142981
Neoplasm Residual	Associate	19055671, 22968966, 24743218, 24816240, 34516636
Neoplasms	Associate	12882984, 15082766, 15310764, 16704439, 16740634, 17069796, 17920239, 18359981, 18420587, 19103589, 19581289, 20027629, 20237089, 20333249, 20424160 View all (49 more)
Neoplasms	Inhibit	21689627, 24410879, 24616519
Neoplasms	Stimulate	27959455, 34326696, 34335635
Neoplasms Squamous Cell	Associate	19066330
Neural Tube Defects	Associate	36823396
Nonseminomatous germ cell tumor	Associate	31513277
Noonan Syndrome	Associate	32712325
Osteosarcoma	Associate	18448670
Ovarian Neoplasms	Associate	25865359, 33741265
Pancreatic Neoplasms	Associate	35142956
Parkinson Disease	Inhibit	26621506
Parkinson Disease	Associate	34335635
Personality Disorders	Associate	25865359
Philadelphia Chromosome	Associate	22691121
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30126426
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16704439, 19055671, 19067680, 20148885, 20212148, 22348345, 22568493, 22681934, 23480665, 23742937, 25421715, 26847745, 27022003, 27470916, 27748301 View all (21 more)
Prostatic Neoplasms	Associate	24860838
Rectal Neoplasms	Associate	20027629
Retinal Dysplasia	Associate	18480108, 20203266, 30902805, 36959701
Ring Chromosome 20 Syndrome	Associate	39768795
Sarcoma Ewing	Associate	35899387
Sarcoma Myeloid	Associate	33171486
Scleroderma Systemic	Associate	14730621
Seminoma	Associate	31513277
Squamous Cell Carcinoma of Head and Neck	Associate	19581289, 35715770, 36834892
Stomach Neoplasms	Associate	20440860, 24358147, 34224728
Stomach Neoplasms	Inhibit	24410879
Thrombocytopenia	Associate	36959701
Trichoscyphodysplasia	Associate	39336484
Triple Negative Breast Neoplasms	Associate	31307523
Typical Teratoid Rhabdoid Tumor	Associate	31462227
Urinary Bladder Neoplasms	Associate	17920239, 23183654
Urinary Bladder Neoplasms	Stimulate	27959455
Uterine Cervical Neoplasms	Associate	25818168
Vascular Diseases	Associate	14730621
Vascular Malformations	Associate	37705750

NPM1 (nucleophosmin 1)