Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4867
Gene name Gene Name - the full gene name approved by the HGNC.
Nephrocystin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPHP1
Synonyms (NCBI Gene) Gene synonyms aliases
JBTS4, NPH1, SLSN1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with src homology domain 3 (SH3) patterns. This protein interacts with Crk-associated substrate, and it appears to function in the control of cell division, as well as in cell-cell and cell-matrix adhesion signaling, likely as
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs114250691 A>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs121907898 A>C,T Pathogenic Stop gained, coding sequence variant, missense variant
rs121907899 C>A,T Pathogenic Coding sequence variant, missense variant
rs140446520 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, intron variant, missense variant
rs140469160 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT670620 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT670619 hsa-miR-764 HITS-CLIP 23824327
MIRT670618 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT670617 hsa-miR-1224-3p HITS-CLIP 23824327
MIRT670616 hsa-miR-1234-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity NAS 12006559
GO:0005515 Function Protein binding IPI 12244321, 12872122, 15661758, 16374509, 18633336, 20664800, 20856870, 21357692, 21565611, 21633164, 23532844, 25825872, 26638075, 27173435, 29959317, 33961781
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607100 7905 ENSG00000144061
Protein
UniProt ID O15259
Protein name Nephrocystin-1 (Juvenile nephronophthisis 1 protein)
Protein function Together with BCAR1 it may play a role in the control of epithelial cell polarity (By similarity). Involved in the organization of apical junctions in kidney cells together with NPHP4 and RPGRIP1L/NPHP8 (By similarity). Does not seem to be stric
PDB 1S1N , 6O1Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 158 204 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widespread expression, with highest levels in pituitary gland, spinal cord, thyroid gland, testis, skeletal muscle, lymph node and trachea. Weakly expressed in heart, kidney and pancreas. Expressed in nasal epithelial cells (at protein
Sequence
MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENK
NALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEVGAPTEEEEE
SESEDSEDSGGEEEDAEEEEEEKEENESHKWSTGEEYIAVGDFTAQQVGDLTFKKGEILL
VIEKKPDGWWIAKDAKGNEGLVPR
TYLEPYSEEEEGQESSEEGSEEDVEAVDETADGAEV
KQRTDPHWSAVQKAISEAGIFCLVNHVSFCYLIVLMRNRMETVEDTNGSETGFRAWNVQS
RGRIFLVSKPVLQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQL
AFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSN
IHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRNST
GERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQI
MTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQ
STDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCV
LPLLHSTRLPPFRWAEEETETARWKVITDFLKQNQENQGALQALLSPDGVHEPFDLSEQT
YDFLGEMRKNAV
Sequence length 732
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Joubert Syndrome Joubert syndrome and related disorders rs1017750255, rs376974221 N/A
Joubert Syndrome With Renal Defect joubert syndrome with renal defect rs1233478832, rs766524637, rs1017750255, rs376974221, rs1311042980, rs121907899, rs753517219, rs398123285, rs765263671 N/A
Nephronophthisis nephronophthisis 1, nephronophthisis rs766524637, rs1017750255, rs121907898, rs376974221, rs1679148969, rs121907899, rs1311042980, rs1553484094, rs747861275, rs1682584195, rs398123285, rs765263671, rs753517219, rs1233478832, rs1349732291 N/A
retinal dystrophy Retinal dystrophy rs121907899 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bardet-Biedl Syndrome Bardet-Biedl syndrome N/A N/A GenCC
Cerebellar vermis agenesis familial aplasia of the vermis N/A N/A ClinVar
focal segmental glomerulosclerosis Focal segmental glomerulosclerosis N/A N/A ClinVar
Leber Congenital Amaurosis leber congenital amaurosis N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 40725491
Agenesis of Cerebellar Vermis Associate 15138899, 15467982, 15786477, 16155189, 16900087, 17960139, 18950740, 22982934, 28347285, 28596487, 28667057, 30055837, 37131188, 37296294, 37735380
Alzheimer Disease Associate 22710270
Apraxia oculomotor Cogan type Associate 37131188
Arrest of spermatogenesis Associate 26198798
Autism Spectrum Disorder Associate 28254236
Brain Stem Neoplasms Associate 17160906
Capillary Malformation Arteriovenous Malformation Associate 16900087
Cholestasis Associate 36227438
Ciliopathies Associate 21068128, 21357692, 21866095, 22982934, 27491411, 28596487, 29146700, 35764379, 36227438