Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4862
Gene name Gene Name - the full gene name approved by the HGNC.	Neuronal PAS domain protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPAS2
Synonyms (NCBI Gene) Gene synonyms aliases	MOP4, PASD4, bHLHe9
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a m

Show/Hide all(106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018156	hsa-miR-335-5p	Microarray	18185580
MIRT050815	hsa-miR-17-5p	CLASH	23622248
MIRT042271	hsa-miR-484	CLASH	23622248
MIRT296914	hsa-miR-93-5p	Microarray, qRT-PCR	22815788
MIRT1190291	hsa-miR-103a	CLIP-seq
MIRT1190292	hsa-miR-107	CLIP-seq
MIRT1190293	hsa-miR-1179	CLIP-seq
MIRT1190294	hsa-miR-1229	CLIP-seq
MIRT1190295	hsa-miR-1273f	CLIP-seq
MIRT1190296	hsa-miR-1295	CLIP-seq
MIRT1190297	hsa-miR-1825	CLIP-seq
MIRT1190298	hsa-miR-190	CLIP-seq
MIRT1190299	hsa-miR-190b	CLIP-seq
MIRT1190300	hsa-miR-199a-5p	CLIP-seq
MIRT1190301	hsa-miR-199b-5p	CLIP-seq
MIRT1190302	hsa-miR-296-3p	CLIP-seq
MIRT1190303	hsa-miR-30a	CLIP-seq
MIRT1190304	hsa-miR-30b	CLIP-seq
MIRT1190305	hsa-miR-30c	CLIP-seq
MIRT1190306	hsa-miR-30d	CLIP-seq
MIRT1190307	hsa-miR-30e	CLIP-seq
MIRT1190308	hsa-miR-342-5p	CLIP-seq
MIRT1190309	hsa-miR-3668	CLIP-seq
MIRT1190310	hsa-miR-3674	CLIP-seq
MIRT1190311	hsa-miR-409-5p	CLIP-seq
MIRT1190312	hsa-miR-4264	CLIP-seq
MIRT1190313	hsa-miR-4310	CLIP-seq
MIRT1190314	hsa-miR-4433	CLIP-seq
MIRT1190315	hsa-miR-4528	CLIP-seq
MIRT1190316	hsa-miR-4651	CLIP-seq
MIRT1190317	hsa-miR-4664-5p	CLIP-seq
MIRT1190318	hsa-miR-4684-3p	CLIP-seq
MIRT1190319	hsa-miR-4699-5p	CLIP-seq
MIRT1190320	hsa-miR-4703-3p	CLIP-seq
MIRT1190321	hsa-miR-4717-5p	CLIP-seq
MIRT1190322	hsa-miR-4718	CLIP-seq
MIRT1190323	hsa-miR-4756-3p	CLIP-seq
MIRT1190324	hsa-miR-4766-5p	CLIP-seq
MIRT1190325	hsa-miR-4793-3p	CLIP-seq
MIRT1190326	hsa-miR-4797-3p	CLIP-seq
MIRT1190327	hsa-miR-508-5p	CLIP-seq
MIRT1190328	hsa-miR-520a-5p	CLIP-seq
MIRT1190329	hsa-miR-525-5p	CLIP-seq
MIRT1190330	hsa-miR-556-3p	CLIP-seq
MIRT1190331	hsa-miR-595	CLIP-seq
MIRT1190332	hsa-miR-608	CLIP-seq
MIRT1190333	hsa-miR-629	CLIP-seq
MIRT1190334	hsa-miR-630	CLIP-seq
MIRT1190335	hsa-miR-661	CLIP-seq
MIRT1190336	hsa-miR-665	CLIP-seq
MIRT1551809	hsa-miR-19a	CLIP-seq
MIRT1551810	hsa-miR-19b	CLIP-seq
MIRT2284062	hsa-miR-214	CLIP-seq
MIRT1190303	hsa-miR-30a	CLIP-seq
MIRT1190304	hsa-miR-30b	CLIP-seq
MIRT1190305	hsa-miR-30c	CLIP-seq
MIRT1190306	hsa-miR-30d	CLIP-seq
MIRT1190307	hsa-miR-30e	CLIP-seq
MIRT2284063	hsa-miR-3198	CLIP-seq
MIRT2284064	hsa-miR-3619-5p	CLIP-seq
MIRT2284065	hsa-miR-4291	CLIP-seq
MIRT2284066	hsa-miR-4309	CLIP-seq
MIRT2284067	hsa-miR-432	CLIP-seq
MIRT2284068	hsa-miR-4653-3p	CLIP-seq
MIRT2284069	hsa-miR-499a-5p	CLIP-seq
MIRT2284070	hsa-miR-761	CLIP-seq
MIRT2284071	hsa-miR-890	CLIP-seq
MIRT2284072	hsa-miR-922	CLIP-seq
MIRT2439048	hsa-miR-216a	CLIP-seq
MIRT2439049	hsa-miR-216b	CLIP-seq
MIRT2439050	hsa-miR-4753-3p	CLIP-seq
MIRT2439051	hsa-miR-4768-5p	CLIP-seq
MIRT2439048	hsa-miR-216a	CLIP-seq
MIRT2439049	hsa-miR-216b	CLIP-seq
MIRT2439050	hsa-miR-4753-3p	CLIP-seq
MIRT2439051	hsa-miR-4768-5p	CLIP-seq
MIRT2582179	hsa-miR-1182	CLIP-seq
MIRT2582180	hsa-miR-1207-5p	CLIP-seq
MIRT2582181	hsa-miR-1288	CLIP-seq
MIRT2582182	hsa-miR-2110	CLIP-seq
MIRT2582183	hsa-miR-3144-5p	CLIP-seq
MIRT2582184	hsa-miR-3150a-3p	CLIP-seq
MIRT2582185	hsa-miR-3189-3p	CLIP-seq
MIRT2582186	hsa-miR-3191	CLIP-seq
MIRT2582187	hsa-miR-3199	CLIP-seq
MIRT2582188	hsa-miR-4418	CLIP-seq
MIRT2582189	hsa-miR-4652-5p	CLIP-seq
MIRT2582190	hsa-miR-4736	CLIP-seq
MIRT2582191	hsa-miR-4763-3p	CLIP-seq
MIRT2582192	hsa-miR-509-3-5p	CLIP-seq
MIRT2582193	hsa-miR-509-5p	CLIP-seq
MIRT2582179	hsa-miR-1182	CLIP-seq
MIRT2582180	hsa-miR-1207-5p	CLIP-seq
MIRT2582181	hsa-miR-1288	CLIP-seq
MIRT2582182	hsa-miR-2110	CLIP-seq
MIRT2582183	hsa-miR-3144-5p	CLIP-seq
MIRT2582184	hsa-miR-3150a-3p	CLIP-seq
MIRT2582185	hsa-miR-3189-3p	CLIP-seq
MIRT2582186	hsa-miR-3191	CLIP-seq
MIRT2582187	hsa-miR-3199	CLIP-seq
MIRT2582188	hsa-miR-4418	CLIP-seq
MIRT2582189	hsa-miR-4652-5p	CLIP-seq
MIRT2582190	hsa-miR-4736	CLIP-seq
MIRT2582191	hsa-miR-4763-3p	CLIP-seq
MIRT2582192	hsa-miR-509-3-5p	CLIP-seq
MIRT2582193	hsa-miR-509-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
KAT2B	Unknown	14645221

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IDA	11441146
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9012850
GO:0005515	Function	Protein binding	IPI	14645221, 20211142, 24722188, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	14645221
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	18819933
GO:0007417	Process	Central nervous system development	TAS	9012850
GO:0009410	Process	Response to xenobiotic stimulus	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0045739	Process	Positive regulation of DNA repair	IMP	18819933
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11441146
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	18819933
GO:0046872	Function	Metal ion binding	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0051775	Process	Response to redox state	IDA	11441146
GO:0051775	Process	Response to redox state	IEA
GO:0051879	Function	Hsp90 protein binding	IDA	9079689
GO:1990513	Component	CLOCK-BMAL transcription complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

MIM	HGNC	e!Ensembl
603347	7895	ENSG00000170485

Protein

UniProt ID

Q99743

Protein name

Neuronal PAS domain-containing protein 2 (Neuronal PAS2) (Basic-helix-loop-helix-PAS protein MOP4) (Class E basic helix-loop-helix protein 9) (bHLHe9) (Member of PAS protein 4) (PAS domain-containing protein 4)

Protein function

Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	10 → 60	Helix-loop-helix DNA-binding domain	Domain
PF00989	PAS	84 → 176	PAS fold	Domain
PF14598	PAS_11	248 → 355		Domain

Sequence

MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR

Sequence length

824

Interactions

View interactions

	KEGG		Reactome
	Circadian rhythm		BMAL1:CLOCK,NPAS2 activates circadian gene expression PPARA activates gene expression Circadian Clock

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Non-obstructive azoospermia	non-obstructive azoospermia	rs879253743	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Age of onset of adult onset asthma	N/A	N/A	GWAS
Tremor	Essential tremor	N/A	N/A	GWAS

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	37120564, 37155150, 38291048
Arthritis Rheumatoid	Associate	23335987, 26710124
Bipolar Disorder	Associate	19839995, 20072116, 25989161
Breast Neoplasms	Associate	17453337, 18819933, 19649706, 22473669, 23822714, 25485508, 28333141, 29958276
Carcinogenesis	Associate	18819933, 19457610, 19649706
Carcinoma Hepatocellular	Associate	24754267, 28333141
Carcinoma Non Small Cell Lung	Associate	35575281
Cognition Disorders	Associate	28412756
Colitis Ulcerative	Associate	37154720
Colorectal Neoplasms	Associate	38092774
Death	Associate	24754267
Depressive Disorder	Associate	20072116
Endometrial Neoplasms	Associate	36748323
Fatigue Syndrome Chronic	Associate	21912186
Glioma	Associate	35832846
Heart Failure	Associate	36699999
Heredodegenerative Disorders Nervous System	Associate	19457610
Immune System Diseases	Associate	23335987
Inflammation	Associate	23335987, 37154720
Leiomyosarcoma	Stimulate	30518396
Leiomyosarcoma	Associate	30518396
Leukemia Lymphocytic Chronic B Cell	Associate	25227809
Lung Neoplasms	Associate	34925645
Lymphatic Metastasis	Stimulate	37398880
Lymphoma B Cell	Associate	17096334
Lymphoma Non Hodgkin	Associate	17096334, 18819933
Melanoma	Associate	28799406
Mental Disorders	Associate	37154720
Neonatal hemochromatosis	Associate	30657733
Neoplasm Metastasis	Associate	37398880
Neoplasms	Inhibit	17096334, 25227809
Neoplasms	Associate	17096334, 18819933, 19457610, 19649706, 28333141, 29958276, 30843665, 33858483, 38291048
Osteoporotic Fractures	Associate	23449886
Prostatic Neoplasms	Associate	19934327, 29318656, 35154101
Prostatic Neoplasms	Stimulate	28699174
Prostatitis	Associate	19934327
Psychotic Disorders	Associate	19839995
Sarcoma	Associate	30518396
Sarcoma	Stimulate	30518396
Schizophrenia	Associate	19839995
Sleep Apnea Obstructive	Associate	39375341
Sleepiness	Associate	21533241
Stomach Neoplasms	Associate	37398880
Urinary Bladder Neoplasms	Associate	33858483

NPAS2 (neuronal PAS domain protein 2)