Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4862
Gene name Gene Name - the full gene name approved by the HGNC.
Neuronal PAS domain protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPAS2
Synonyms (NCBI Gene) Gene synonyms aliases
MOP4, PASD4, bHLHe9
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a m
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018156 hsa-miR-335-5p Microarray 18185580
MIRT050815 hsa-miR-17-5p CLASH 23622248
MIRT042271 hsa-miR-484 CLASH 23622248
MIRT296914 hsa-miR-93-5p Microarray, qRT-PCR 22815788
MIRT1190291 hsa-miR-103a CLIP-seq
Transcription factors
Transcription factor Regulation Reference
KAT2B Unknown 14645221
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603347 7895 ENSG00000170485
Protein
UniProt ID Q99743
Protein name Neuronal PAS domain-containing protein 2 (Neuronal PAS2) (Basic-helix-loop-helix-PAS protein MOP4) (Class E basic helix-loop-helix protein 9) (bHLHe9) (Member of PAS protein 4) (PAS domain-containing protein 4)
Protein function Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 10 60 Helix-loop-helix DNA-binding domain Domain
PF00989 PAS 84 176 PAS fold Domain
PF14598 PAS_11 248 355 Domain
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGS
LNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYAD
VRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
Sequence length 824
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Circadian rhythm   BMAL1:CLOCK,NPAS2 activates circadian gene expression
PPARA activates gene expression
Circadian Clock
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Non-obstructive azoospermia non-obstructive azoospermia rs879253743 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Age of onset of adult onset asthma N/A N/A GWAS
Tremor Essential tremor N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37120564, 37155150, 38291048
Arthritis Rheumatoid Associate 23335987, 26710124
Bipolar Disorder Associate 19839995, 20072116, 25989161
Breast Neoplasms Associate 17453337, 18819933, 19649706, 22473669, 23822714, 25485508, 28333141, 29958276
Carcinogenesis Associate 18819933, 19457610, 19649706
Carcinoma Hepatocellular Associate 24754267, 28333141
Carcinoma Non Small Cell Lung Associate 35575281
Cognition Disorders Associate 28412756
Colitis Ulcerative Associate 37154720
Colorectal Neoplasms Associate 38092774