CNOT4 (CCR4-NOT transcription complex subunit 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4850
Gene name Gene Name - the full gene name approved by the HGNC.
CCR4-NOT transcription complex subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNOT4
Synonyms (NCBI Gene) Gene synonyms aliases
CLONE243, NOT4, NOT4H
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been fou
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(725)
miRTarBase ID miRNA Experiments Reference
MIRT004947 hsa-miR-98-5p qRT-PCR 17942906
MIRT020314 hsa-miR-130b-3p Sequencing 20371350
MIRT021203 hsa-miR-186-5p Sequencing 20371350
MIRT028102 hsa-miR-93-5p Sequencing 20371350
MIRT030177 hsa-miR-26b-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening TAS
GO:0003723 Function RNA binding HDA 22681889
GO:0004842 Function Ubiquitin-protein transferase activity IBA 21873635
GO:0004842 Function Ubiquitin-protein transferase activity IDA 15001359, 26575292
GO:0005515 Function Protein binding IPI 15001359, 26575292
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604911 7880 ENSG00000080802
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95628
Protein name CCR4-NOT transcription complex subunit 4 (EC 2.3.2.27) (CCR4-associated factor 4) (E3 ubiquitin-protein ligase CNOT4) (Potential transcriptional repressor NOT4Hp) (RING-type E3 ubiquitin transferase CNOT4)
Protein function Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins (PubMed:11823428, PubMed:22159038, PubMed:26575292). Involved in activation of the JAK/STAT pathway (PubMed:11823428, PubMed:22159038). Catalyzes ubiqu
PDB 1E4U , 1UR6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14570 zf-RING_4 14 → 61 Domain
PF00076 RRM_1 111 → 187 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence 
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPY
PEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRL
ADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV
VDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKL
LQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTP
SPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQT
SSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQ
QHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIP
VAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA
Sequence length 575
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  RNA degradation   Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental Depression Mental Depression GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 34626022
Glaucoma Open Angle Associate 29847670
Neoplasms Associate 34626022
Periodontitis Associate 35397550