Gene Gene information from NCBI Gene database.
Entrez ID 4848
Gene name CCR4-NOT transcription complex subunit 2
Gene symbol CNOT2
Synonyms (NCBI Gene)
CDC36HSPC131IDNADFSNOT2NOT2H
Chromosome 12
Chromosome location 12q15
Summary This gene encodes a subunit of the multi-component CCR4-NOT complex. The CCR4-NOT complex regulates mRNA synthesis and degradation and is also thought to be involved in mRNA splicing, transport and localization. The encoded protein interacts with histone
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1593269476 A>T Pathogenic Stop gained, coding sequence variant, non coding transcript variant, downstream transcript variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
217
miRTarBase ID miRNA Experiments Reference
MIRT051943 hsa-let-7b-5p CLASH 23622248
MIRT044094 hsa-miR-361-5p CLASH 23622248
MIRT036704 hsa-miR-301b-3p CLASH 23622248
MIRT615077 hsa-miR-1264 HITS-CLIP 23824327
MIRT615076 hsa-miR-9500 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 14707134, 16712523
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening IBA
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening NAS 31320642
GO:0000932 Component P-body IBA
GO:0001222 Function Transcription corepressor binding IDA 16712523
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604909 7878 ENSG00000111596
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZN8
Protein name CCR4-NOT transcription complex subunit 2 (CCR4-associated factor 2)
Protein function Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiati
PDB 4C0D , 4C0F , 5FU6 , 5FU7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04153 NOT2_3_5 396 521 NOT2 / NOT3 / NOT5 family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes. {ECO:0000269|PubMed:10637334}.
Sequence
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLA
SPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMS
LHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQ
PSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRRE
GSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS
NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGL
LTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSE
YLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWIT
RAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKL
EERPHLPSTFNYNPAQQAF
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  RNA degradation   Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
7
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Intellectual developmental disorder with nasal speech, dysmorphic facies, and variable skeletal anomalies Pathogenic rs1593269476 RCV000852366
Neurodevelopmental disorder Likely pathogenic rs2136104001 RCV001374950
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CNOT2-related disorder Uncertain significance; Likely benign rs1443243067, rs2499098662 RCV003393179
RCV003976851
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 28640357
Breast Neoplasms Associate 30692147, 34680125, 34698000
Carcinoma Hepatocellular Associate 32316188, 34680125
Carcinoma Non Small Cell Lung Associate 31894259
Colorectal Neoplasms Associate 34680125
Lung Neoplasms Associate 34680125
Lymphoma Large B Cell Diffuse Associate 26294112
Neoplasms Associate 23583282, 34680125
Pancreatic Neoplasms Associate 37550432
Salivary Duct Calculi Associate 23583282