NOS2 (nitric oxide synthase 2)

Gene

• Entrez ID: 4843
• Gene name: Nitric oxide synthase 2
• Gene symbol: NOS2
• Synonyms (NCBI Gene): HEP-NOS, INOS, NOS, NOS2A
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducibl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007347	hsa-miR-26a-5p	qRT-PCR, Western blot	23338972
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT732802	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33318876
MIRT737162	hsa-miR-939-5p	qRT-PCR	33368266
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT1189580	hsa-miR-1291	CLIP-seq
MIRT1189581	hsa-miR-146b-3p	CLIP-seq
MIRT1189582	hsa-miR-4330	CLIP-seq
MIRT2283906	hsa-miR-2682	CLIP-seq
MIRT2283907	hsa-miR-323-5p	CLIP-seq
MIRT2283908	hsa-miR-3614-5p	CLIP-seq
MIRT2283909	hsa-miR-3616-5p	CLIP-seq
MIRT2283910	hsa-miR-3647-5p	CLIP-seq
MIRT2283911	hsa-miR-3714	CLIP-seq
MIRT2283912	hsa-miR-4457	CLIP-seq
MIRT2283913	hsa-miR-449c	CLIP-seq
MIRT2283914	hsa-miR-4635	CLIP-seq
MIRT2283915	hsa-miR-4731-3p	CLIP-seq
MIRT2283916	hsa-miR-4801	CLIP-seq
MIRT2283917	hsa-miR-573	CLIP-seq
MIRT2283918	hsa-miR-876-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APC	Activation	11935128
FOS	Activation	12788789
FOS	Repression	9776360
FOSL2	Activation	12788789
IKBKB	Repression	17478759
JUN	Activation	12788789
JUN	Repression	9776360
JUN	Unknown	14962367
JUND	Activation	12788789
KLF6	Activation	12590140
KLF6	Unknown	23831683
MTA1	Activation	20022949
NFKB1	Activation	15350552;17081374;17720813;18057724
NFKB1	Unknown	11438703;15170030;16283237;16318585;19766095
NFKBIA	Repression	17478759
RELA	Activation	15350552;17081374;17720813;18057724
RELA	Unknown	15170030;16283237;16318585;19766095;9712833
STAT1	Activation	12586443
STAT1	Unknown	16318585
STAT2	Activation	12586443
XBP1	Unknown	20637858
YY1	Unknown	20430007

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001912	Process	Positive regulation of leukocyte mediated cytotoxicity	TAS	10450191
GO:0002227	Process	Innate immune response in mucosa	NAS	18390757
GO:0004517	Function	Nitric-oxide synthase activity	IBA	21873635
GO:0004517	Function	Nitric-oxide synthase activity	IDA	7504305, 7682706
GO:0005515	Function	Protein binding	IPI	12855682, 21199876, 25417112
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	9916929, 12085352
GO:0005777	Component	Peroxisome	IDA	12085352
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IMP	7504305
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006527	Process	Arginine catabolic process	IBA	21873635
GO:0006527	Process	Arginine catabolic process	IDA	7504305
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0006801	Process	Superoxide metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IBA	21873635
GO:0006809	Process	Nitric oxide biosynthetic process	IDA	7504305, 7682706
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007263	Process	Nitric oxide mediated signal transduction	IBA	21873635
GO:0007623	Process	Circadian rhythm	IEA
GO:0009617	Process	Response to bacterium	NAS	12085352
GO:0009725	Process	Response to hormone	IBA	21873635
GO:0010181	Function	FMN binding	IBA	21873635
GO:0010181	Function	FMN binding	ISS
GO:0010629	Process	Negative regulation of gene expression	IGI	12085352
GO:0012506	Component	Vesicle membrane	IBA	21873635
GO:0016491	Function	Oxidoreductase activity	IBA	21873635
GO:0016709	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IBA	21873635
GO:0018119	Process	Peptidyl-cysteine S-nitrosylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0020037	Function	Heme binding	ISS
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0031284	Process	Positive regulation of guanylate cyclase activity	IBA	21873635
GO:0032310	Process	Prostaglandin secretion	IDA	19688109
GO:0032496	Process	Response to lipopolysaccharide	IBA	21873635
GO:0032635	Process	Interleukin-6 production	IDA	19688109
GO:0032637	Process	Interleukin-8 production	IDA	19688109
GO:0034617	Function	Tetrahydrobiopterin binding	ISS
GO:0034618	Function	Arginine binding	ISS
GO:0035690	Process	Cellular response to drug	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042742	Process	Defense response to bacterium	IBA	21873635
GO:0042742	Process	Defense response to bacterium	IMP	9284131
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043457	Process	Regulation of cellular respiration	TAS	10450191
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0045776	Process	Negative regulation of blood pressure	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA	21873635
GO:0050660	Function	Flavin adenine dinucleotide binding	ISS
GO:0050661	Function	NADP binding	TAS	7504305
GO:0050796	Process	Regulation of insulin secretion	IMP	8383325
GO:0050829	Process	Defense response to Gram-negative bacterium	NAS	18390757
GO:0051712	Process	Positive regulation of killing of cells of other organism	IMP	7544003
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to interferon-gamma	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	19688109

Other IDs

• MIM: 163730
• HGNC: 7873
• e!Ensembl: ENSG00000007171

Protein

• UniProt ID: P35228
• Protein name: Nitric oxide synthase, inducible (EC 1.14.13.39) (Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2)
• Protein function: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body (PubMed:7504305, PubMed:7531687, PubMed:7544004, PubMed:7682706). In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitr
• PDB: 1NSI, 2LL6, 2NSI, 3E7G, 3EJ8, 3HR4, 4CX7, 4NOS, 5TP6, 5XN3, 6JWM, 6JWN, 6KEY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02898	NO_synthase	135 → 497	Nitric oxide synthase, oxygenase domain	Domain
  PF00258	Flavodoxin_1	541 → 672	Flavodoxin	Domain
  PF00667	FAD_binding_1	725 → 947	FAD binding domain	Domain
  PF00175	NAD_binding_1	979 → 1093	Oxidoreductase NAD-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets. Expressed in chondrocytes (PubMed:7504305). {ECO:0000269|PubMed:7504305}.
• Sequence:

  MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
  VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
  TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
  LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
  RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
  RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
  GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
  AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
  LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
  ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
  NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
  ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
  SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
  PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
  LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
  PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
  VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
  EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
  VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
  VAVQPSSLEMSAL

• Sequence length: 1153

Pathways

KEGG:

Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Apelin signaling pathway
Relaxin signaling pathway
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Pertussis
Leishmaniasis
Chagas disease
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer

Reactome:

ROS and RNS production in phagocytes
Nitric oxide stimulates guanylate cyclase
Interleukin-4 and Interleukin-13 signaling
Peroxisomal protein import
Inhibition of nitric oxide production

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542	18563708
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	15631943
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	15631943
Cholestasis	Cholestasis, Extrahepatic, Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	30026087, 12612912, 20626112
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	16105666, 21081470
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	16959961
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	15264214
Hypertension	Hypertensive disease, Essential Hypertension	rs13306026	27292124, 25101153, 18605955
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	18441258
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	12460898, 22369883
Marfan syndrome	Marfan Syndrome, Mammary Carcinoma, Human, Marfan Syndrome, Type I	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465, rs137854466, rs137854467, rs387906547, rs387906548, rs137854469, rs137854473, rs1131692050, rs112989722, rs137854474, rs137854476, rs140593, rs1555395819, rs137854478, rs137854479, rs137854480, rs137854481, rs137854482, rs137854483, rs137854484, rs137854485, rs112289537, rs193922181, rs193922182, rs193922185, rs140603, rs193922187, rs193922188, rs193921256, rs112660651, rs193922193, rs193922194, rs193922197, rs193922198, rs193922199, rs193922203, rs193922204, rs193922205, rs193922206, rs111401431, rs193922207, rs113871094, rs111671429, rs193922216, rs193922219, rs193922220, rs193922223, rs193922224, rs193922225, rs193922226, rs193922227, rs193922228, rs193922230, rs193922235, rs147195031, rs193922236, rs193922239, rs193922240, rs193922241, rs193922246, rs397514558, rs398122934, rs397515753, rs397515754, rs397515755, rs397515756, rs397515757, rs113812345, rs397515758, rs397515759, rs397515762, rs25403, rs397515765, rs397515766, rs397515767, rs397515768, rs397515769, rs397515770, rs397515771, rs25404, rs397515773, rs397515774, rs397515775, rs397515776, rs397515778, rs397515779, rs397515781, rs112202622, rs397515782, rs397515784, rs397515785, rs397515786, rs397515788, rs397515789, rs397515790, rs397515791, rs397515792, rs397515793, rs397515794, rs397515797, rs397515798, rs397515799, rs397515801, rs397515802, rs397515803, rs397515804, rs397515805, rs397515808, rs397515810, rs397515811, rs397515812, rs111231312, rs267606798, rs397515814, rs113905529, rs397515816, rs397515817, rs397515818, rs397515819, rs397515820, rs363853, rs113249837, rs397515821, rs111929350, rs397515823, rs397515824, rs113086760, rs397515825, rs397515826, rs397515827, rs363807, rs397515828, rs397515829, rs397515830, rs397515831, rs397515833, rs111687884, rs113080385, rs397515834, rs397515836, rs113001196, rs397515840, rs397515845, rs397515846, rs397515847, rs397515848, rs397515851, rs397515852, rs397515853, rs397515854, rs111856492, rs397515859, rs397515861, rs397515863, rs397515864, rs397515865, rs397515866, rs397515867, rs137854855, rs199474693, rs587782944, rs587782947, rs587782948, rs672601352, rs876658120, rs727504651, rs727503054, rs727504315, rs727504411, rs727503057, rs727504454, rs200309328, rs363811, rs727504410, rs363821, rs727504347, rs727505006, rs727505110, rs730880356, rs727505269, rs727503058, rs727504421, rs730880107, rs730880104, rs730880103, rs730880102, rs730880101, rs730880106, rs730880100, rs730880105, rs730880099, rs112645512, rs730880108, rs730880098, rs730880097, rs794728321, rs794728283, rs794728280, rs794728336, rs794728272, rs794728160, rs794728271, rs794728270, rs794728319, rs794728262, rs794728251, rs76702162, rs794728335, rs794728334, rs794728246, rs763091520, rs794728333, rs794728237, rs761857514, rs794728234, rs140630, rs794728231, rs794728228, rs794728225, rs794728308, rs794728216, rs794728221, rs763449629, rs201058219, rs794728210, rs794728208, rs794728206, rs794728199, rs794728195, rs794728194, rs794728193, rs794728190, rs1555399381, rs794728176, rs1555399968, rs113422242, rs794728326, rs794728166, rs794728325, rs794728165, rs794728162, rs794728213, rs869025417, rs112642323, rs869025416, rs869025415, rs869025424, rs869025423, rs869025414, rs869025422, rs869025413, rs869025412, rs869025411, rs869025418, rs869025426, rs869025406, rs869025421, rs869025425, rs869025404, rs869025420, rs869025403, rs398122833, rs876657645, rs878853686, rs878853676, rs886038919, rs886038795, rs187553035, rs886038869, rs886038949, rs886038967, rs886038976, rs886038848, rs886038940, rs886038877, rs886039038, rs886038817, rs886038963, rs886039036, rs886038797, rs886039550, rs886041482, rs1057517855, rs1057518912, rs1057518973, rs1057519502, rs1057521100, rs1057521102, rs1057518881, rs1057520617, rs1057521101, rs1555394445, rs369058466, rs1060501069, rs1060501031, rs778966916, rs1060501043, rs1555397663, rs1060501017, rs1060501094, rs1060501065, rs1555393848, rs1555394151, rs1060501051, rs1060501013, rs1060501054, rs1060501048, rs1060501089, rs1060501039, rs1555398160, rs1060501022, rs1060501024, rs1060501086, rs1060501058, rs1060501036, rs1060501100, rs1060501042, rs1060501059, rs1555397743, rs1060501021, rs1060501027, rs1060501096, rs1060501038, rs1060501050, rs1064794130, rs112118237, rs1064793980, rs1064793118, rs1064793636, rs1064794282, rs1064793559, rs1085307921, rs1085308004, rs1085307468, rs112907302, rs1131691479, rs1131691373, rs1131691467, rs1131691938, rs1131691311, rs1131691806, rs1131691317, rs1555393827, rs363804, rs1555397738, rs1555399144, rs1555400274, rs1555394195, rs1555398836, rs113543334, rs1555399825, rs1555394626, rs1555395256, rs1555395257, rs1555396427, rs1555397548, rs1555398173, rs1555404803, rs1232880706, rs1555393825, rs1555394567, rs1555396998, rs1555394928, rs1555397203, rs112375043, rs1555397720, rs140599, rs1555399150, rs1555400373, rs1555405041, rs1555395229, rs1555397671, rs775417975, rs1555398774, rs1555399368, rs1555394904, rs1555395987, rs1555397424, rs1555398377, rs1555398835, rs1555401011, rs1555405043, rs1555394580, rs1555397404, rs1555398511, rs1555395826, rs1555399372, rs1555399821, rs1555399836, rs1555400063, rs363810, rs1555397655, rs1555395756, rs1555395742, rs1555393844, rs112550005, rs1555395002, rs1555395658, rs765387131, rs1555396429, rs1555396835, rs1555397014, rs1555397016, rs778710767, rs1555397557, rs1555397704, rs140648, rs1555398406, rs1555398681, rs1555399257, rs1555399361, rs1555399764, rs1555405056, rs1555393510, rs1555395980, rs1555396789, rs1555399094, rs1555399378, rs1555399816, rs1555395645, rs371097218, rs1555398278, rs1555394238, rs1555396418, rs1206813753, rs1555399271, rs1555405044, rs113544411, rs1555395663, rs1555397216, rs1555398989, rs1555399149, rs1555401670, rs1555395001, rs1445085747, rs1555393538, rs1555393565, rs1404133653, rs1555394450, rs1555394581, rs1555394633, rs1555394900, rs1555395189, rs1555395261, rs1052480459, rs1555395480, rs1555395670, rs363806, rs1555395820, rs1555396419, rs1555396765, rs1296209846, rs794728233, rs1555396853, rs1555396863, rs1555397197, rs1555397204, rs1555397212, rs1555397713, rs1555397736, rs1555398139, rs1555398144, rs1555398409, rs1555398510, rs1555398520, rs1555398524, rs1555398667, rs1555399089, rs1555399482, rs1555399763, rs1555401002, rs794728323, rs1555393508, rs1555393514, rs1555393525, rs1555393532, rs1555393653, rs1555393657, rs1555393824, rs1555393831, rs112196241, rs1555393847, rs1555393862, rs1555393863, rs1555393866, rs113935744, rs1555393882, rs1555393886, rs1555393889, rs1555394138, rs1555394144, rs1555394146, rs1555394148, rs1555394149, rs1555394152, rs1555394153, rs1555394189, rs1555394197, rs1555394206, rs1555394212, rs1555394218, rs1555394220, rs1555394235, rs1555394245, rs1555394246, rs1057520728, rs1555394390, rs1555394391, rs537570299, rs1555394397, rs1555394398, rs1555394399, rs1555394402, rs1555394407, rs1555394412, rs1555394435, rs1555394436, rs1555394441, rs1555394556, rs1555394557, rs1555394559, rs1555394561, rs1555394570, rs397515844, rs1555394571, rs1555394574, rs1555394579, rs1555394582, rs534811966, rs111588631, rs1555394628, rs1555394629, rs1555394630, rs1555394631, rs1555394641, rs1555394644, rs1555394647, rs1555394756, rs886051245, rs1555394775, rs1555394776, rs1555394777, rs1555394779, rs1555394780, rs1555394783, rs1555394901, rs1555394906, rs1555394925, rs794728253, rs886039158, rs1555395013, rs1555395187, rs1555395188, rs1555395203, rs1555395205, rs363815, rs1246984265, rs794728245, rs1555395263, rs1555395267, rs1555395456, rs1555395475, rs1555395482, rs1555395638, rs1555395641, rs1555395648, rs1555395653, rs1555395659, rs111239111, rs1555395745, rs1555395747, rs1555395753, rs1555395757, rs1555395766, rs1555395767, rs1555395843, rs1555395846, rs1555395849, rs1555395978, rs1555395981, rs1555395984, rs1555395989, rs1555395990, rs1260109901, rs1555396186, rs1555396188, rs1555396198, rs1555396199, rs1555396201, rs1555396202, rs1555396205, rs1555396213, rs1555396424, rs1555396426, rs1555396428, rs1555396435, rs1555396630, rs1555396635, rs1555396636, rs1555396639, rs1555396757, rs1555396769, rs1555396838, rs1555396844, rs140627, rs1555396858, rs1555396990, rs1555396991, rs1555396993, rs769588424, rs1555397022, rs1555397024, rs1555397160, rs1555397174, rs1555397176, rs1555397193, rs1555397209, rs1555397210, rs1555397214, rs1060501076, rs113082854, rs113693945, rs111978932, rs1555397403, rs1555397419, rs1555397420, rs1555397421, rs1555397536, rs1555397537, rs1555397540, rs1555397542, rs1555397543, rs1555397545, rs1555397546, rs1555397670, rs1555397692, rs1555397718, rs1555397723, rs1555397744, rs113393517, rs1555398148, rs1555398152, rs1555398174, rs1555398176, rs1555398179, rs1555398282, rs1555398287, rs1555398380, rs1555398394, rs1555398397, rs1555398401, rs1555398404, rs1555398407, rs1555398413, rs1555398501, rs1555398508, rs1555398512, rs1555398513, rs1555398515, rs1555398521, rs794728205, rs1555398527, rs1555398551, rs1060501075, rs1555398566, rs1555398572, rs1555398580, rs1555398582, rs140597, rs1555398622, rs1555398624, rs1555398625, rs112547596, rs1555398627, rs1555398633, rs1555398637, rs1555398642, rs778867355, rs1555398648, rs1555398659, rs1293095681, rs1060501040, rs987202268, rs1555398672, rs1555398673, rs1555398677, rs1555398793, rs1555398803, rs1555398811, rs1555398826, rs1555398833, rs1555398974, rs1555398981, rs778900586, rs1555398988, rs1555398994, rs1555398995, rs1555398996, rs1555399093, rs869025405, rs1555399101, rs1555399146, rs1555399160, rs1555399162, rs1555399164, rs1555399165, rs1555399193, rs1555399195, rs1555399202, rs1555399204, rs1555399206, rs201778577, rs1555399210, rs1555399214, rs1555399270, rs1555399273, rs1555399281, rs1555399371, rs1555399385, rs1555399477, rs1555399484, rs1555399761, rs1555399775, rs1555399802, rs1555399804, rs1555399837, rs1555399840, rs1555399940, rs1555399944, rs1555399949, rs1555399953, rs1555399954, rs1555399955, rs1555399959, rs1555399962, rs1555399963, rs1060501041, rs1555399974, rs1555399976, rs1555399977, rs1555400049, rs794728172, rs1555400062, rs1555400064, rs1555400066, rs1555400267, rs1555400268, rs1555400278, rs794728168, rs1555400279, rs1156747241, rs1555400288, rs1555400371, rs1555400372, rs1555400379, rs1555400385, rs587782943, rs1555400387, rs1555400406, rs1439533354, rs746201757, rs1555400595, rs1555400603, rs1555400604, rs1555400606, rs1555400609, rs752010116, rs1555400612, rs1555400616, rs1555401004, rs1555401005, rs146348130, rs1555401667, rs1555401671, rs1555401676, rs1555401679, rs1555401687, rs1555401689, rs1555401695, rs1555401697, rs1555401701, rs1555404799, rs1555404800, rs200295020, rs1555404810, rs1555404820, rs1555405031, rs1555405039, rs1555405045, rs1555405530, rs794728292, rs1555405533, rs1555405536, rs1555405537, rs111764111, rs1555405658, rs1555405664, rs774371494, rs1555405673, rs1555407399, rs1555407414, rs1555407423, rs1555407429, rs886041536, rs1555404806, rs1566911709, rs1566913974, rs1566894226, rs1566895223, rs1566897376, rs1566902526, rs1566915277, rs1566897374, rs1566897420, rs1566891655, rs1346043320, rs1566922396, rs1566891706, rs1566894783, rs1566913670, rs1555394196, rs1566891454, rs1566891406, rs1566891404, rs1566895262, rs1566891645, rs1566895225, rs1566896114, rs1566898399, rs1566904011, rs1566906537, rs1566908956, rs1566909766, rs1566919599, rs1566937712, rs1566915335, rs1566891675, rs1566904526, rs1566906506, rs1566900540, rs1566894230, rs1555395206, rs1566891797, rs1597512576, rs1597523873, rs1597581001, rs1597516325, rs1057524757, rs1597506641, rs1597520781, rs1597593695, rs1597529829, rs1597520625, rs1597579923, rs1597531796, rs1008275504, rs1597567249, rs1597569265, rs1597652471, rs1597516347, rs1597577114, rs1597633163, rs1597519658, rs1597593852, rs1597516501, rs1566913982, rs1555393859, rs1597513708, rs368978109, rs1480832655, rs1597520683, rs1597522390, rs1597522553, rs1597529748, rs1597533707, rs1597537815, rs1597545309, rs1597545836, rs1597563234, rs1597563280, rs1597564359, rs772108557, rs1597568968, rs1597574236, rs1597574308, rs1597577975, rs193922179, rs1597581005, rs1597593736, rs1597623670, rs1597625734, rs1597631662, rs113604459, rs1597633183, rs1597633219, rs1597518951, rs1555394781, rs1597525871, rs1597526073, rs1597569159, rs1597569536, rs1597563934, rs1597545199, rs1364210063, rs1597552583, rs1597520619, rs1597540854, rs1597591602, rs1597569551, rs1597548716, rs1597553721, rs112728248, rs1597537858, rs1597517935, rs1597540907, rs1597552388, rs1597591643, rs1597529841, rs1597506547, rs1597509836, rs1597529686, rs1566897404, rs1597533713, rs1597543486, rs1597545257, rs1597545345, rs1597548672, rs1597562812, rs1597563287, rs1597571391, rs1555400052, rs1597583989, rs363852, rs1597547226, rs363808, rs974604498, rs2043595650, rs2043526284, rs2042997306, rs1555397195, rs886039054, rs1555397213, rs2042873946	25101153, 15631943
Parkinson disease	Parkinson Disease, Secondary Vascular, Secondary Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121918104, rs1589451049, rs104893877, rs104893878, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	25634431
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007, 20953189, 25574825, 23143594, 25903422
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	19559095

Unknown
Disease term	Disease name	Evidence	References	Source
Asthma	Asthma		19800904	ClinVar
Atherosclerosis	Atherosclerosis		20720404	ClinVar
Cholangiocarcinoma	Cholangiocarcinoma, Extrahepatic Cholangiocarcinoma		16818635	ClinVar
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		21843929	ClinVar
Congestive heart failure	Congestive heart failure		19168511	ClinVar
Crohn disease	Crohn Disease		26974007	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided		19168511	ClinVar
Mental depression	Mental Depression, Depressive disorder		22989585, 22959237, 21630437, 19571147, 21750947	ClinVar
Myocardial infarction	Myocardial Infarction, Myocardial Failure		11489778, 10090345, 19168511	ClinVar
Ankylosing Spondylitis	Ankylosing Spondylitis			GWAS
Mental Depression	Mental Depression			GWAS
Psoriasis vulgaris	Psoriasis vulgaris			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Aberrant Crypt Foci	Associate	12800233
Abortion Habitual	Associate	19217092
Abortion Spontaneous	Associate	19217092
Acrodermatitis	Associate	17324275
Acute malaria	Associate	28793894
Adenocarcinoma	Associate	10970689, 12800233, 7531687
Adenocarcinoma Follicular	Stimulate	17179688
Adenoma	Stimulate	17179688
Adenoma Oxyphilic	Associate	17179688
Aggressive Periodontitis	Associate	27737359
AIDS Dementia Complex	Associate	11471556, 8784788
AIDS related Kaposi sarcoma	Associate	14656937
Airway Obstruction	Associate	11028658, 34782693
Alzheimer Disease	Associate	36982725, 8879214
Amyotrophic Lateral Sclerosis	Stimulate	29246232
Anemia	Associate	15271950
Anemia Sickle Cell	Associate	18809239
Angina Unstable	Associate	11869847
Anodontia	Stimulate	23523904
Anophthalmia with pulmonary hypoplasia	Associate	37852325
Anthropophobia	Associate	33048872
Aortic Aneurysm Abdominal	Associate	12891121, 28735510
Arteriosclerosis	Associate	17227851, 9327724
Arthritis	Associate	12296866
Arthritis Psoriatic	Associate	12507903, 20953189, 22298274, 8920887
Arthritis Rheumatoid	Associate	16427328, 19242068, 19854161, 27626941, 29993142
Arthritis Rheumatoid	Stimulate	9064335
Asbestosis	Associate	21660141
Asphyxia	Associate	29931509
Asthma	Associate	11312402, 15038835, 16081849, 17189532, 18714530, 21039601, 22092728, 23101307, 24518246, 24587191, 27021121, 28424066, 28821285, 30667100, 34106513, 34946286
Astrocytoma	Associate	16724682, 9065411
Atherosclerosis	Associate	15363632, 17492134, 23893050, 25550806, 35791925, 37575057
Atrial Fibrillation	Associate	28205526
Autoimmune Diseases	Associate	9665402
Barrett Esophagus	Associate	16049281
Barrett Esophagus	Stimulate	31700071
Behcet Syndrome	Associate	27114698
Blindness	Associate	16288199
Bone Diseases	Associate	40570323
Brain Injuries	Associate	29931509
Brain Injuries Traumatic	Stimulate	23894384
Brain Neoplasms	Associate	18820242
Breast Neoplasms	Associate	15917410, 22957045, 22971289, 23167903, 23261943, 26547585, 32112882, 35584114, 36936167, 37169743
Breast Neoplasms	Stimulate	28162269
Bronchial Hyperreactivity	Associate	7524082
Bronchiolitis	Associate	29253610
Bronchiolitis Viral	Associate	29253610
Bronchopulmonary Dysplasia	Stimulate	18500734
Burns	Associate	35363228
Cachexia	Associate	15170030
Calcinosis Cutis	Inhibit	36306210
Calculi	Associate	18676870
Carcinogenesis	Associate	15063730, 16681724, 17438334, 19300368, 20565800, 24044375, 26547585, 37660159
Carcinoma Adenoid Cystic	Associate	19317804
Carcinoma Hepatocellular	Associate	16273602, 25691007, 30297396
Carcinoma Non Small Cell Lung	Associate	22107611, 33316778
Carcinoma Ovarian Epithelial	Associate	16681724, 19962178
Carcinoma Pancreatic Ductal	Associate	31609478
Carcinoma Squamous Cell	Associate	19387481, 22718118
Carcinoma Squamous Cell	Inhibit	26577853
Cardiomyopathy Dilated	Associate	9091515
Cardiovascular Diseases	Associate	19668373, 29100088
Carotid Stenosis	Associate	21393601
Cartilage Diseases	Associate	11597171, 34616553
Cataract	Associate	17015954, 17202650
CD59 Deficiency	Associate	27114698
Celiac Disease	Associate	12121878
Cerebral Arterial Diseases	Associate	14997934
Cerebral Palsy	Associate	29931509
Chronic Periodontitis	Associate	24363500, 27737359, 28617311
Ciliary Motility Disorders	Associate	21273388
Cleft Palate	Associate	21857382
Cognition Disorders	Associate	19286578
Colitis	Stimulate	22662201
Colitis Associated Neoplasms	Associate	28408791, 38187473
Colitis Collagenous	Stimulate	31131860
Colitis Ulcerative	Stimulate	11511561, 15753535, 16586542
Colitis Ulcerative	Associate	12678336, 16049281, 27104830, 28408791, 33299870, 36982725, 9536941, 9771406
Colonic Neoplasms	Associate	11114180, 17438334, 20069397
Colorectal Neoplasms	Associate	11304846, 12598314, 14719508, 15905073, 16049281, 16419170, 16937436, 19925669, 22531693, 23077543, 25541970, 25854428, 26547585, 26647627, 28408791, 29522543, 30590117, 30773944, 34373442, 35698180, 7524602
Colorectal Neoplasms	Stimulate	29074106
Colorectal Neoplasms	Inhibit	36306210
Communicable Diseases	Associate	9771406
Communicable Diseases	Stimulate	9916929
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	28656540
Congenital Hyperinsulinism	Associate	23869231
Constriction Pathologic	Associate	10394152
Coronary Disease	Associate	20581851, 37679988
COVID 19	Associate	34176789
Crohn Disease	Stimulate	16586542
Cystic Fibrosis	Associate	11491175, 15107292
Cystic Fibrosis	Inhibit	12704103, 12948935, 16517573
Cystitis	Associate	25523514, 29207018
Death	Associate	37569597
Dental Plaque	Associate	28214453
Dermatitis Contact	Stimulate	9394976
Dermatomyositis	Associate	26806087
Diabetes Gestational	Stimulate	26568332
Diabetes Mellitus	Associate	19175688, 21854353, 26568332, 28711598, 37754589
Diabetes Mellitus Type 2	Associate	27192959, 35791925, 36768884
Diabetic Nephropathies	Associate	27192959
Diabetic Retinopathy	Associate	22363694
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	17687170
Disease	Associate	18278557
Distal myopathy Nonaka type	Associate	23496965
DNA Virus Infections	Associate	16128740
Down Syndrome	Associate	25222269
Drug Hypersensitivity	Stimulate	9394976
Drug Related Side Effects and Adverse Reactions	Associate	12216084, 24054867, 24148766, 36768884
Dysentery Bacillary	Associate	9009337
Dysplastic Nevus Syndrome	Inhibit	22470562
Eczema	Associate	36889660
Edema	Associate	15227628
Encephalitis Viral	Associate	7530762
Endometriosis	Stimulate	23935397
Endophthalmitis	Associate	31267172
Enterocolitis Necrotizing	Associate	28315470, 33663574
Eosinophilic Esophagitis	Associate	30455683
Epilepsy Partial with Variable Foci	Associate	12800233
Epilepsy Post Traumatic	Associate	37465758
Episodic Ataxia	Associate	38465533
Esophageal Neoplasms	Associate	16425431, 33275591, 33541291
Esophageal Neoplasms	Stimulate	23082063
Esophageal Squamous Cell Carcinoma	Associate	25875558, 32872669
Fallopian Tube Diseases	Associate	19692623
Fatigue Syndrome Chronic	Associate	25878398
Fetal Death	Associate	37569597
Fetal Growth Retardation	Inhibit	15983116
Fever	Associate	12709575
Fibromyalgia	Associate	25878398
Fibrosis	Associate	12485814, 22811738, 24141615
Fractures Bone	Associate	37465758
Fuchs' Endothelial Dystrophy	Associate	26138903
Gallbladder Neoplasms	Associate	14991947
Gastritis	Associate	11267845, 19797925, 25309933, 34471638
Gastritis Atrophic	Associate	11978184
Glaucoma	Associate	16288199, 25564962
Glaucoma Open Angle	Associate	16288199, 33963197
Glioblastoma	Associate	18820242, 29440272, 30227679, 30991141, 31226744, 7531687
Glioma	Associate	23714583, 28424427, 30227679, 36076540
Glomerulonephritis	Associate	8840265
Glomerulonephritis IGA	Associate	8840265
Glucose Intolerance	Stimulate	35478445
Glucose Metabolism Disorders	Associate	26568332
Glucosephosphate Dehydrogenase Deficiency	Associate	32630408
Granuloma	Associate	10573228, 32566036, 9916929
Hantavirus Infections	Associate	26561052
Haspeslagh Fryns Muelenaere syndrome	Associate	29164949
Heart Defects Congenital	Stimulate	19912632
Heart Defects Congenital	Associate	27450023
Heart Diseases	Associate	10091837, 15862412, 20022263
Heart Failure	Associate	11691525, 12957433, 15334196, 26778769, 32844595, 9768718
Heart Failure	Stimulate	15862412, 22201951
Helicobacter Infections	Associate	15484300, 19797925, 23002365
HELLP Syndrome	Inhibit	16097974
Hepatitis Viral Human	Associate	9525976
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	26547585
Heredodegenerative Disorders Nervous System	Associate	10068656
Histiocytic Necrotizing Lymphadenitis	Associate	9916929
Histiocytoma Malignant Fibrous	Associate	17233833
HIV Infections	Inhibit	26647762
Hyperglycemia	Stimulate	35607962
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	22363694, 35791925
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	26568332
Hypersensitivity Immediate	Associate	26831417
Hypertension	Associate	16097974, 21931069, 23266817, 26579803, 33973418, 36833440
Hypertension Pregnancy Induced	Stimulate	21787174
Hypertension Pulmonary	Associate	19912632
Hypoxia	Stimulate	20151982, 24462831, 28483502
Hypoxia Brain	Associate	18717816
Ichthyosis Lamellar	Associate	32544098
Idiopathic Noncirrhotic Portal Hypertension	Associate	12482944
Immune System Diseases	Associate	22107611
Infections	Associate	18278557, 22636782, 24379293, 38271857, 9916929
Infections	Stimulate	23438852
Inflammation	Associate	10759457, 11112784, 12437583, 12957433, 15222037, 15363632, 16049281, 16806998, 16950790, 17075573, 17202660, 17233833, 17277882, 17438334, 18098375, 18500734, 18714530, 19300368, 20555352, 20818651, 21489226, 21854562, 23255592, 23496965, 25222269, 25309933, 25523514, 25634431, 25878398, 26453114, 26547585, 26647627, 27307355, 28012244, 28121247, 28162269, 28162271, 28244985, 28315470, 28711598, 28821285, 29232919, 29243793, 29246232, 30008606, 30044769, 31269760, 31411316, 32399898, 33244148, 33368275, 33821330, 34029561, 34106513, 35409364, 35478445, 35608548, 35684465, 36364344, 36462310, 36614295, 36768884, 36982725, 37175777, 37242259, 37269815, 37329158, 37373544, 37401041, 37465758, 38187473, 38367463, 40076528, 8920887, 9009337, 9327724, 9614127, 9916929
Inflammation	Stimulate	12678336, 18225538, 23894384, 27021121
Inflammation	Inhibit	31267172
Inflammatory Bowel Diseases	Associate	10023337, 10446104, 10516652, 11076874, 11304846, 11352817, 16586542, 29307990, 31322753, 38187473
Insulin Resistance	Associate	22797309
Intervertebral disc disease	Associate	21837414
Intestinal Diseases	Associate	11978184
Intestinal Polyposis	Associate	23101307
Intracranial Aneurysm	Associate	25966199
Intrahepatic Cholestasis of Pregnancy	Associate	33846282
Ischemia	Associate	27082814, 34967938
Joint Diseases	Associate	19854161
Keratosis Actinic	Associate	22718118
Kidney Diseases	Associate	12110011, 9607210
Kidney Failure Chronic	Stimulate	12123211
Kidney Failure Chronic	Associate	21854353
Leiomyoma	Associate	28483502, 30841718
Leprosy	Associate	9737674
Leprosy Lepromatous	Associate	26515838
Leprosy Tuberculoid	Inhibit	26515838
Leprosy Tuberculoid	Associate	36982725
Leukemia	Associate	9680373
Leukemia Lymphocytic Chronic B Cell	Associate	9680373
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	12714496
Leukomalacia Periventricular	Stimulate	19415311
Lichen Planus Oral	Associate	16128740
Liver Cirrhosis	Associate	12482944, 20003711
Lung Diseases Interstitial	Associate	38086271
Lung Neoplasms	Associate	17922468, 18008356, 18644994, 24408018
Lung Neoplasms	Stimulate	9716040
Lupus Erythematosus Cutaneous	Associate	9665402
Lupus Erythematosus Systemic	Associate	9665402
Lymphatic Metastasis	Associate	11978184, 14991947, 15609395, 15849807, 19300368, 24044375
Lymphoma	Associate	23338972
Lymphoma B Cell Marginal Zone	Associate	15222024
Lymphoma Non Hodgkin	Associate	12944556
Lymphoma T Cell	Associate	23338972
Macular Degeneration	Associate	20374233
Macular Edema	Associate	40332476
Malaria	Associate	19859740, 24379293, 28793894
Malaria	Inhibit	28793894
Malaria Cerebral	Associate	24379293
Malaria Falciparum	Associate	19859740
Malformations of Cortical Development Group I	Associate	14997934, 32229084
Marfan Syndrome	Associate	37445606
Melanoma	Associate	10188914, 18472017, 18511292, 18668140, 19039588, 21953496, 26547585
Melanoma Cutaneous Malignant	Stimulate	17328085
Melanoma Cutaneous Malignant	Associate	17328085, 19039588
MELAS Syndrome	Associate	23263669
Meningioma	Associate	18820242
Mesothelioma	Associate	10970689
Mesothelioma Malignant	Associate	10970689
Microcephaly	Associate	33672623
Microvascular Angina	Inhibit	24864190
Mitochondrial Diseases	Associate	12709575, 30595795
Mitochondrial encephalopathy	Associate	23263669
Mucocutaneous Lymph Node Syndrome	Associate	28069066
Mucositis	Associate	11076874
Multiple Chemical Sensitivity	Associate	25878398
Multiple Myeloma	Associate	27983725
Multiple Sclerosis	Associate	11395383, 15275951, 23826716, 35732787, 8618840
Muscular Atrophy	Associate	19470832
Myelodysplastic Syndromes	Associate	37366304
Myocardial Infarction	Associate	11869847, 24806096, 32399898
Myocardial Infarction	Stimulate	32399898
Myocardial Ischemia	Associate	19286578
Myofibrillar Myopathy	Associate	17784878
Myotilinopathy	Associate	17784878
Myotonic Dystrophy	Inhibit	38271857
Nasal Polyps	Associate	31827697, 37224640
Nasopharyngeal Carcinoma	Associate	25446398, 26453114
Neoplasm Metastasis	Associate	10188914, 14991947, 36306210
Neoplasm Metastasis	Stimulate	15222037
Neoplasms	Associate	10188914, 10363563, 11267845, 11978184, 12216084, 12404284, 12598314, 12800233, 12875991, 14719508, 15063730, 15222037, 15754329, 15785755, 15849807, 15917410, 16094703, 16681724, 17179688, 17328085, 17922468, 18008356, 18441394, 18472017, 18644994, 18668140, 19132106, 19168583, 20069397, 20074466, 20565800, 20959455, 20963646, 21143607, 21489226, 22012771, 22957045, 22971289, 23077543, 23106339, 23238815, 23338972, 23690221, 23832257, 24044375, 24416147, 25691007, 25875558, 26453114, 26523280, 26547585, 26782976, 28121247, 28162285, 28424427, 29440272, 30227679, 30297396, 30570876, 30590117, 30657629, 31358801, 32872669, 33714729, 34428455, 34439753, 34440860, 35584114, 36306210, 37169743, 37351172, 37506784, 37660159, 38087324, 7528687, 7531687, 7541238
Neoplasms	Stimulate	15259072, 15905073, 19178812, 26257474, 9716040
Neoplasms	Inhibit	37852325
Neural Tube Defects	Associate	24323870
Neuroblastoma	Associate	37351172
Neurodegenerative Diseases	Associate	18663495
Neuroinflammatory Diseases	Associate	18278557
Neurologic Manifestations	Associate	15063753
Neurotoxicity Syndromes	Associate	30953815, 8879214
Nose Diseases	Associate	18714530, 23101307
Obesity	Associate	15231849, 31988533
Obesity	Stimulate	18098375, 31787760
Oral Submucous Fibrosis	Stimulate	17687170
Osteoarthritis	Associate	10555036, 11597171, 15922185, 16427328, 19854161, 23523904, 26560022, 27307355, 30261513, 33540799, 35508470
Osteoarthritis Hip	Associate	33540799
Osteoarthritis Knee	Associate	39809203
Osteoglophonic dwarfism	Associate	32096202
Osteomyelitis	Associate	37465758
Osteophyte	Associate	11300746
Osteosarcoma	Associate	23263669, 28387915
Otitis	Associate	24434259
Otitis Media with Effusion	Associate	24434259
Ovarian Neoplasms	Associate	16681724, 19132106, 24842412
Ovarian Neoplasms	Inhibit	36757936
Pain	Associate	27498764
Pancreatic Neoplasms	Inhibit	25557640
Pancreatic Neoplasms	Associate	28121247, 37852325
Pancreatitis	Associate	23438852
Parkinson Disease	Associate	10212304, 18663495, 22776646, 26383258, 36352407
Parkinson Disease Secondary	Associate	25634431
Pemphigus	Associate	16648905
Peri Implantitis	Associate	32996143
Periodontal Diseases	Associate	27737359
Periodontitis	Associate	28617311
Persistent Infection	Stimulate	17234397
Phyllodes Tumor	Associate	15917410
Placenta Diseases	Associate	16097974
Pneumonia	Associate	9361997
Polycystic Ovary Syndrome	Inhibit	29055959
Postpartum Thyroiditis	Associate	37569597
Pre Eclampsia	Stimulate	21787174
Pre Eclampsia	Associate	37817070
Precancerous Conditions	Associate	11267845
Preeclamptic toxemia	Stimulate	15983116
Pregnancy Ectopic	Associate	19692623
Primary Myelofibrosis	Associate	30570876
Prostate Cancer Hereditary 7	Associate	28162285
Prostatic Diseases	Associate	20562898
Prostatic Hyperplasia	Associate	20562898
Prostatic Neoplasms	Associate	18619832, 19168583, 20562898, 22859398, 23106339, 23998439, 26068242, 28162285, 38087324
Prostatic Neoplasms	Stimulate	19168583
Prostatitis	Associate	35872082
Psoriasis	Associate	12507903, 20953189, 22298274, 26806281, 31612239, 36889660
Pulmonary Arterial Hypertension	Associate	16813666, 36833440
Pulmonary Disease Chronic Obstructive	Associate	12797490, 15170030, 16135718, 21843929, 23811074, 37088001
Pulmonary Disease Chronic Obstructive	Stimulate	17675371, 26063358
Pulmonary Edema	Associate	15227628
Pulmonary edema of mountaineers	Associate	26436397
Pulmonary Eosinophilia	Associate	21679473
Pulmonary Heart Disease	Associate	24141615
Rabies	Associate	16568727
Rectal Neoplasms	Associate	22531693
Reperfusion Injury	Associate	27082814, 32652873
Respiratory Distress Syndrome	Associate	16568727, 30231236
Retinal Dysplasia	Associate	11978184, 17687170
Retinoblastoma	Associate	15754329
Ring Chromosome 20 Syndrome	Stimulate	23523904, 27082814, 31159591
Sarcoidosis	Associate	10573228, 9916929
Sarcoidosis Pulmonary	Associate	10573228
Scleroderma Systemic	Associate	14632763, 16813666, 24141615
Sepsis	Stimulate	14997934
Severe Acute Respiratory Syndrome	Associate	24518246
Shock Septic	Associate	14997934, 21612615
Shoulder Injuries	Associate	25595362
Sjogren's Syndrome	Stimulate	27207443
Skin Diseases	Associate	12507903, 26806281, 34669971, 8920887, 9665402
Sleep Apnea Obstructive	Associate	18098375, 18413499
Soft Tissue Injuries	Associate	27207443, 31267172
Soft Tissue Injuries	Stimulate	9327724
Spinocerebellar Ataxia Autosomal Recessive 2	Associate	18621123
Squamous Cell Carcinoma of Head and Neck	Associate	12404284, 16128740, 18225538, 18441394, 19300368, 22012771, 26523280, 35634436
Squamous Cell Carcinoma of Head and Neck	Stimulate	12875991, 32092078, 37161060
Status Asthmaticus	Associate	11028658, 15038835, 16889281, 24587191, 27021121, 28424066, 28797075
Stevens Johnson Syndrome	Stimulate	22992806
Stomach Diseases	Associate	32630408
Stomach Neoplasms	Associate	11978184, 12174362, 15484300, 15609395, 15849807, 17072962, 20565800, 23002365, 23372371, 24044375, 28128738
Stomach Neoplasms	Stimulate	34439753
Sweet Syndrome	Associate	34669971
Systemic Inflammatory Response Syndrome	Associate	20151982, 28800779
Tension Type Headache	Associate	36833440
Tertiary Lymphoid Structures	Associate	12216084
Thyroid Cancer Papillary	Associate	17179688
Thyroid Neoplasms	Associate	17179688
Thyroiditis	Associate	17179688
Tonsillar Neoplasms	Associate	19178812
Tonsillitis	Stimulate	19178812
Tuberculosis	Stimulate	14977928, 9623681
Tuberculosis	Associate	19575238
Tuberculosis	Inhibit	24558401
Tuberculosis Pulmonary	Associate	19575238, 24558401, 9623681
Ureteral Obstruction	Associate	15458429
Urethral Neoplasms	Associate	24054867
Urinary Bladder Neoplasms	Associate	24315573, 37660159
Urolithiasis	Associate	37878647
Uterine Cervical Dysplasia	Associate	18559542, 25875558
Uterine Cervical Neoplasms	Associate	26257474
Uveitis Anterior	Associate	32492107
Varicose Veins	Associate	15838489
Vascular Diseases	Associate	12891121, 17492134, 25550806, 29637536, 35791925, 37575057
Vascular System Injuries	Associate	35607962
Venous Insufficiency	Stimulate	32141705
Ventricular Dysfunction Left	Associate	12485814
Virus Diseases	Stimulate	9525976
Vitiligo	Associate	22205923, 29186858
Voice Disorders	Associate	25564962
Wounds and Injuries	Associate	28315470
Zika Virus Infection	Associate	33672623